Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A166B0R4

Protein Details
Accession A0A166B0R4    Localization Confidence Medium Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
194-213DAELKKRKAHESHAKRHHAHBasic
NLS Segment(s)
PositionSequence
184-213KRALRKREAADAELKKRKAHESHAKRHHAH
Subcellular Location(s) nucl 12.5, cyto_nucl 10, cyto 6.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR037176  Osmotin/thaumatin-like_sf  
Amino Acid Sequences MPSLVRSCYQQGADANCCGCVDWEDILGAENVPSSTTRCVNKNPLWASTIQPTLEWLKKGVPSGYTYPYDDMSSTSTCNNNVGDWNAQNYIVELCPGGVYWGVPGNAPAPAPAPEPTPEPAPAPAPSSEPAPAPEPTPEPAPAPEPTTQIPAPAPSSEPAPAPAPSSEPAPPAPAPTTCSNTSKRALRKREAADAELKKRKAHESHAKRHHAH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.33
3 0.29
4 0.28
5 0.24
6 0.2
7 0.16
8 0.15
9 0.12
10 0.13
11 0.12
12 0.12
13 0.13
14 0.12
15 0.1
16 0.07
17 0.07
18 0.06
19 0.07
20 0.07
21 0.09
22 0.12
23 0.17
24 0.21
25 0.24
26 0.31
27 0.39
28 0.43
29 0.5
30 0.49
31 0.46
32 0.44
33 0.42
34 0.39
35 0.35
36 0.33
37 0.24
38 0.21
39 0.21
40 0.25
41 0.26
42 0.24
43 0.2
44 0.2
45 0.22
46 0.24
47 0.23
48 0.2
49 0.2
50 0.23
51 0.26
52 0.25
53 0.25
54 0.24
55 0.23
56 0.22
57 0.18
58 0.16
59 0.14
60 0.13
61 0.13
62 0.14
63 0.14
64 0.14
65 0.15
66 0.14
67 0.12
68 0.13
69 0.14
70 0.14
71 0.13
72 0.15
73 0.14
74 0.13
75 0.12
76 0.11
77 0.1
78 0.08
79 0.08
80 0.05
81 0.05
82 0.05
83 0.05
84 0.05
85 0.04
86 0.03
87 0.04
88 0.06
89 0.06
90 0.06
91 0.06
92 0.06
93 0.07
94 0.07
95 0.07
96 0.06
97 0.07
98 0.08
99 0.08
100 0.09
101 0.1
102 0.12
103 0.13
104 0.14
105 0.14
106 0.13
107 0.14
108 0.14
109 0.14
110 0.14
111 0.13
112 0.14
113 0.14
114 0.14
115 0.14
116 0.13
117 0.14
118 0.14
119 0.14
120 0.13
121 0.14
122 0.15
123 0.15
124 0.16
125 0.15
126 0.14
127 0.15
128 0.16
129 0.16
130 0.17
131 0.18
132 0.18
133 0.19
134 0.22
135 0.21
136 0.2
137 0.19
138 0.18
139 0.18
140 0.16
141 0.17
142 0.13
143 0.15
144 0.14
145 0.14
146 0.14
147 0.15
148 0.14
149 0.15
150 0.15
151 0.15
152 0.15
153 0.17
154 0.16
155 0.16
156 0.17
157 0.19
158 0.18
159 0.2
160 0.21
161 0.19
162 0.23
163 0.25
164 0.3
165 0.29
166 0.34
167 0.35
168 0.38
169 0.43
170 0.47
171 0.53
172 0.58
173 0.63
174 0.66
175 0.71
176 0.71
177 0.75
178 0.71
179 0.65
180 0.65
181 0.65
182 0.67
183 0.66
184 0.63
185 0.56
186 0.55
187 0.6
188 0.56
189 0.58
190 0.59
191 0.61
192 0.7
193 0.78