Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165F846

Protein Details
Accession A0A165F846    Localization Confidence High Confidence Score 18.5
NoLS Segment(s)
PositionSequenceProtein Nature
4-34EDGDKPKRKAAEKSEKKPRAAKKEGPKRALSBasic
96-119AGMEPKTKAKPKKAAKSKSVTPEEHydrophilic
NLS Segment(s)
PositionSequence
8-31KPKRKAAEKSEKKPRAAKKEGPKR
86-113KKRAAKDREDAGMEPKTKAKPKKAAKSK
Subcellular Location(s) nucl 23.5, cyto_nucl 12.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
Amino Acid Sequences MPKEDGDKPKRKAAEKSEKKPRAAKKEGPKRALSAYMFFVQAERETVKEENPDAGFGELGKLLGARWKEMSDKDKKPYTELAEADKKRAAKDREDAGMEPKTKAKPKKAAKSKSVTPEEDQVDDDDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.74
3 0.79
4 0.83
5 0.83
6 0.82
7 0.82
8 0.8
9 0.79
10 0.77
11 0.76
12 0.76
13 0.8
14 0.84
15 0.81
16 0.73
17 0.66
18 0.6
19 0.57
20 0.47
21 0.39
22 0.32
23 0.28
24 0.26
25 0.23
26 0.2
27 0.14
28 0.13
29 0.13
30 0.1
31 0.09
32 0.11
33 0.12
34 0.13
35 0.14
36 0.14
37 0.16
38 0.15
39 0.15
40 0.13
41 0.12
42 0.11
43 0.09
44 0.09
45 0.05
46 0.05
47 0.04
48 0.04
49 0.03
50 0.06
51 0.07
52 0.07
53 0.08
54 0.09
55 0.11
56 0.15
57 0.22
58 0.27
59 0.32
60 0.37
61 0.42
62 0.41
63 0.42
64 0.44
65 0.42
66 0.39
67 0.36
68 0.36
69 0.41
70 0.41
71 0.4
72 0.38
73 0.34
74 0.31
75 0.38
76 0.35
77 0.31
78 0.37
79 0.39
80 0.4
81 0.42
82 0.41
83 0.37
84 0.4
85 0.36
86 0.31
87 0.31
88 0.33
89 0.39
90 0.46
91 0.5
92 0.55
93 0.64
94 0.74
95 0.79
96 0.83
97 0.83
98 0.84
99 0.83
100 0.83
101 0.8
102 0.73
103 0.66
104 0.64
105 0.58
106 0.51
107 0.44