Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A165I5D8

Protein Details
Accession A0A165I5D8    Localization Confidence Low Confidence Score 8.2
NoLS Segment(s)
PositionSequenceProtein Nature
79-104ASDAYRRSWPKHPRSKRTSLKYLVSCHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 10, cyto 7.5, cyto_mito 7.5, mito 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004045  Glutathione_S-Trfase_N  
IPR036249  Thioredoxin-like_sf  
PROSITE View protein in PROSITE  
PS50404  GST_NTER  
Amino Acid Sequences MTTYELHYFNAAARADLSRLLLDFAGASYKNVLVKGVEWGTKQDTTPFGKIPVLVIKDADGSTKVGTYRAIQSVRALPASDAYRRSWPKHPRSKRTSLKYLVSCL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.16
3 0.17
4 0.16
5 0.11
6 0.11
7 0.12
8 0.1
9 0.09
10 0.08
11 0.07
12 0.09
13 0.08
14 0.08
15 0.08
16 0.1
17 0.11
18 0.11
19 0.11
20 0.09
21 0.09
22 0.13
23 0.14
24 0.15
25 0.14
26 0.16
27 0.18
28 0.19
29 0.19
30 0.16
31 0.18
32 0.2
33 0.22
34 0.2
35 0.19
36 0.18
37 0.18
38 0.17
39 0.17
40 0.14
41 0.12
42 0.12
43 0.11
44 0.11
45 0.11
46 0.11
47 0.08
48 0.07
49 0.07
50 0.09
51 0.08
52 0.08
53 0.09
54 0.11
55 0.13
56 0.18
57 0.19
58 0.18
59 0.2
60 0.24
61 0.24
62 0.23
63 0.2
64 0.15
65 0.19
66 0.21
67 0.22
68 0.2
69 0.21
70 0.3
71 0.34
72 0.39
73 0.44
74 0.52
75 0.6
76 0.69
77 0.77
78 0.78
79 0.83
80 0.89
81 0.9
82 0.89
83 0.88
84 0.84
85 0.82