Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A166A973

Protein Details
Accession A0A166A973    Localization Confidence Low Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
69-94VSGPLSKRSQRRSKTRYRSRKCIEDRHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16.5, cyto_nucl 11, cyto 4.5, mito 3
Family & Domain DBs
Amino Acid Sequences MRDVEPELREMSQGPRLFLPIVVANIHRFTRIICLLDQKKSNGDEQWASNPSDASHGQAQDRFEMSSDVSGPLSKRSQRRSKTRYRSRKCIEDR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.23
3 0.24
4 0.24
5 0.22
6 0.21
7 0.15
8 0.15
9 0.15
10 0.15
11 0.15
12 0.17
13 0.18
14 0.15
15 0.13
16 0.12
17 0.17
18 0.18
19 0.17
20 0.16
21 0.24
22 0.27
23 0.32
24 0.33
25 0.29
26 0.3
27 0.3
28 0.31
29 0.23
30 0.22
31 0.2
32 0.19
33 0.22
34 0.21
35 0.2
36 0.18
37 0.17
38 0.15
39 0.16
40 0.15
41 0.13
42 0.14
43 0.14
44 0.16
45 0.18
46 0.18
47 0.17
48 0.18
49 0.15
50 0.13
51 0.13
52 0.12
53 0.11
54 0.11
55 0.1
56 0.09
57 0.11
58 0.11
59 0.14
60 0.2
61 0.25
62 0.32
63 0.41
64 0.51
65 0.59
66 0.69
67 0.74
68 0.8
69 0.85
70 0.89
71 0.9
72 0.9
73 0.91
74 0.89