Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165FD70

Protein Details
Accession A0A165FD70    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
12-33AYLLLVRRLRYRQRDRFLEQFTHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 13, mito 7.5, E.R. 5, cyto_mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR046366  MPAB  
IPR018713  MPAB/Lcp_cat_dom  
Gene Ontology GO:0016491  F:oxidoreductase activity  
Pfam View protein in Pfam  
PF09995  MPAB_Lcp_cat  
Amino Acid Sequences MWLSAVGIAFAAYLLLVRRLRYRQRDRFLEQFTSSELEHMTPATAQKIALNSLHYDNVVTMTLGTYVALFKVFGIPSVASLLIKTGSFENARSISKRLADTNVLLSTLITNPFTGPGSGNDAGIDDPRGAIAVARMNYLHGRYNINNDDMRYNLALFVLEPMKWTAHFDWRPHSPIECQAMFVMWCEIGRRMGIANLWSTLDEMDAWAAAYEEERMQPSEASFELAHTLLEHYYDRLPGIPGARRFLRNVVHSILDERTRRAMGLPDPSPSVRRTVYGLFHLRAFVVRHFCLPRRKPLYWADVKPPGPDGRLHTIYQRRGGPWYYPEATGLAKIKQDIKVSLGILPHEKVPGPQWRSQGYRLEEIGPTRFEREGHEEVMAQAAQIHGQEIKGPLGLRPEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.12
3 0.13
4 0.16
5 0.23
6 0.31
7 0.42
8 0.52
9 0.62
10 0.66
11 0.75
12 0.82
13 0.82
14 0.82
15 0.79
16 0.74
17 0.65
18 0.56
19 0.48
20 0.42
21 0.35
22 0.28
23 0.22
24 0.16
25 0.15
26 0.14
27 0.12
28 0.11
29 0.13
30 0.13
31 0.13
32 0.13
33 0.14
34 0.16
35 0.18
36 0.18
37 0.18
38 0.19
39 0.21
40 0.22
41 0.2
42 0.18
43 0.16
44 0.15
45 0.14
46 0.11
47 0.08
48 0.08
49 0.08
50 0.08
51 0.07
52 0.06
53 0.06
54 0.06
55 0.06
56 0.06
57 0.06
58 0.1
59 0.1
60 0.1
61 0.12
62 0.12
63 0.13
64 0.14
65 0.14
66 0.1
67 0.1
68 0.1
69 0.09
70 0.09
71 0.09
72 0.08
73 0.12
74 0.13
75 0.14
76 0.17
77 0.2
78 0.22
79 0.23
80 0.25
81 0.25
82 0.28
83 0.3
84 0.28
85 0.29
86 0.29
87 0.28
88 0.3
89 0.26
90 0.22
91 0.2
92 0.17
93 0.15
94 0.14
95 0.13
96 0.1
97 0.09
98 0.09
99 0.11
100 0.11
101 0.1
102 0.1
103 0.1
104 0.16
105 0.16
106 0.16
107 0.15
108 0.15
109 0.15
110 0.14
111 0.13
112 0.06
113 0.06
114 0.06
115 0.06
116 0.05
117 0.05
118 0.06
119 0.09
120 0.1
121 0.11
122 0.11
123 0.12
124 0.13
125 0.15
126 0.17
127 0.15
128 0.19
129 0.19
130 0.26
131 0.27
132 0.29
133 0.29
134 0.26
135 0.26
136 0.22
137 0.23
138 0.16
139 0.14
140 0.11
141 0.1
142 0.08
143 0.07
144 0.09
145 0.08
146 0.07
147 0.08
148 0.09
149 0.09
150 0.09
151 0.12
152 0.12
153 0.2
154 0.24
155 0.25
156 0.28
157 0.31
158 0.34
159 0.32
160 0.31
161 0.24
162 0.26
163 0.3
164 0.25
165 0.22
166 0.2
167 0.19
168 0.17
169 0.16
170 0.11
171 0.06
172 0.06
173 0.06
174 0.06
175 0.07
176 0.06
177 0.06
178 0.06
179 0.07
180 0.07
181 0.08
182 0.07
183 0.07
184 0.08
185 0.07
186 0.07
187 0.07
188 0.06
189 0.05
190 0.04
191 0.04
192 0.03
193 0.03
194 0.03
195 0.03
196 0.03
197 0.03
198 0.04
199 0.04
200 0.05
201 0.06
202 0.07
203 0.07
204 0.08
205 0.08
206 0.09
207 0.08
208 0.1
209 0.09
210 0.08
211 0.09
212 0.09
213 0.09
214 0.07
215 0.08
216 0.06
217 0.07
218 0.07
219 0.07
220 0.08
221 0.08
222 0.08
223 0.08
224 0.09
225 0.1
226 0.13
227 0.16
228 0.17
229 0.21
230 0.24
231 0.25
232 0.25
233 0.28
234 0.3
235 0.27
236 0.29
237 0.27
238 0.25
239 0.24
240 0.25
241 0.22
242 0.23
243 0.22
244 0.2
245 0.21
246 0.2
247 0.2
248 0.19
249 0.2
250 0.19
251 0.25
252 0.24
253 0.23
254 0.25
255 0.26
256 0.27
257 0.24
258 0.24
259 0.18
260 0.18
261 0.19
262 0.21
263 0.22
264 0.27
265 0.31
266 0.28
267 0.28
268 0.27
269 0.24
270 0.23
271 0.22
272 0.19
273 0.2
274 0.2
275 0.24
276 0.28
277 0.34
278 0.42
279 0.44
280 0.51
281 0.54
282 0.54
283 0.55
284 0.59
285 0.63
286 0.61
287 0.61
288 0.58
289 0.58
290 0.58
291 0.53
292 0.5
293 0.42
294 0.35
295 0.33
296 0.32
297 0.32
298 0.34
299 0.34
300 0.38
301 0.44
302 0.46
303 0.49
304 0.47
305 0.4
306 0.41
307 0.43
308 0.39
309 0.35
310 0.38
311 0.34
312 0.31
313 0.3
314 0.27
315 0.26
316 0.26
317 0.24
318 0.19
319 0.19
320 0.21
321 0.25
322 0.28
323 0.3
324 0.28
325 0.28
326 0.29
327 0.29
328 0.29
329 0.26
330 0.23
331 0.23
332 0.23
333 0.21
334 0.2
335 0.19
336 0.18
337 0.23
338 0.3
339 0.33
340 0.37
341 0.42
342 0.46
343 0.51
344 0.55
345 0.57
346 0.52
347 0.52
348 0.49
349 0.46
350 0.43
351 0.41
352 0.39
353 0.34
354 0.31
355 0.28
356 0.28
357 0.25
358 0.28
359 0.33
360 0.33
361 0.32
362 0.31
363 0.29
364 0.28
365 0.31
366 0.24
367 0.16
368 0.13
369 0.11
370 0.11
371 0.1
372 0.12
373 0.09
374 0.09
375 0.13
376 0.14
377 0.15
378 0.17
379 0.17
380 0.18