Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I2H4T9

Protein Details
Accession I2H4T9    Localization Confidence Medium Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
122-142DDSSKKRRRDYGTNTSKRLRRBasic
NLS Segment(s)
PositionSequence
126-130KKRRR
Subcellular Location(s) nucl 26.5, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR027141  LSm4/Sm_D1/D3  
IPR010920  LSM_dom_sf  
IPR047575  Sm  
IPR001163  Sm_dom_euk/arc  
Gene Ontology GO:0005634  C:nucleus  
GO:0120114  C:Sm-like protein family complex  
GO:0006396  P:RNA processing  
KEGG tbl:TBLA_0E03370  -  
Pfam View protein in Pfam  
PF01423  LSM  
PROSITE View protein in PROSITE  
PS52002  SM  
Amino Acid Sequences MKLVNFLKKLRNEQLTIELKNGTTIWGTLQTVSPQMNVTLTDITLSLPTNKNPQAQAAFFLASNSNNTSSNSSSNSDIQLQYINVRGNTIRQIILPDSLNLDSLLIDEQQLQRLRKSGKLVDDSSKKRRRDYGTNTSKRLRRGI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.57
3 0.51
4 0.45
5 0.37
6 0.31
7 0.3
8 0.27
9 0.18
10 0.12
11 0.11
12 0.11
13 0.13
14 0.13
15 0.13
16 0.14
17 0.14
18 0.16
19 0.16
20 0.15
21 0.12
22 0.12
23 0.12
24 0.11
25 0.12
26 0.1
27 0.09
28 0.09
29 0.08
30 0.08
31 0.08
32 0.08
33 0.1
34 0.12
35 0.13
36 0.19
37 0.22
38 0.24
39 0.24
40 0.27
41 0.26
42 0.24
43 0.25
44 0.2
45 0.18
46 0.15
47 0.15
48 0.13
49 0.1
50 0.11
51 0.1
52 0.1
53 0.1
54 0.11
55 0.13
56 0.14
57 0.15
58 0.16
59 0.16
60 0.16
61 0.16
62 0.17
63 0.16
64 0.15
65 0.14
66 0.13
67 0.11
68 0.11
69 0.13
70 0.13
71 0.11
72 0.12
73 0.11
74 0.12
75 0.14
76 0.15
77 0.12
78 0.11
79 0.14
80 0.14
81 0.16
82 0.15
83 0.12
84 0.13
85 0.13
86 0.13
87 0.11
88 0.1
89 0.08
90 0.08
91 0.08
92 0.06
93 0.06
94 0.08
95 0.09
96 0.15
97 0.21
98 0.22
99 0.22
100 0.29
101 0.31
102 0.33
103 0.39
104 0.38
105 0.4
106 0.46
107 0.48
108 0.51
109 0.58
110 0.61
111 0.65
112 0.68
113 0.65
114 0.64
115 0.69
116 0.68
117 0.69
118 0.71
119 0.72
120 0.75
121 0.8
122 0.81
123 0.81
124 0.77