Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A165QQK5

Protein Details
Accession A0A165QQK5    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
41-62RKSKGLAPRKKKGTKVNKQGIIBasic
NLS Segment(s)
PositionSequence
34-75NSGRELWRKSKGLAPRKKKGTKVNKQGIIASTKRAGRPSRRR
Subcellular Location(s) mito 14, nucl 7, cyto 6
Family & Domain DBs
Amino Acid Sequences MAVVPEAGVTAGAESMQLDGSAKDKAVSTHGPRNSGRELWRKSKGLAPRKKKGTKVNKQGIIASTKRAGRPSRRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.05
3 0.05
4 0.05
5 0.05
6 0.05
7 0.07
8 0.07
9 0.07
10 0.07
11 0.08
12 0.09
13 0.12
14 0.17
15 0.21
16 0.28
17 0.3
18 0.34
19 0.34
20 0.37
21 0.36
22 0.34
23 0.35
24 0.36
25 0.39
26 0.41
27 0.46
28 0.43
29 0.42
30 0.44
31 0.48
32 0.49
33 0.54
34 0.57
35 0.61
36 0.69
37 0.75
38 0.77
39 0.79
40 0.79
41 0.8
42 0.82
43 0.83
44 0.79
45 0.74
46 0.7
47 0.63
48 0.58
49 0.49
50 0.42
51 0.38
52 0.36
53 0.37
54 0.41
55 0.46