Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165EYW7

Protein Details
Accession A0A165EYW7    Localization Confidence Medium Confidence Score 14.8
NoLS Segment(s)
PositionSequenceProtein Nature
117-162KPKKVVPRSKVKAKPVPKTAPKKVAGKPKPKAPTPKKTVRRPAVSLHydrophilic
NLS Segment(s)
PositionSequence
104-105KA
112-158PLPGAKPKKVVPRSKVKAKPVPKTAPKKVAGKPKPKAPTPKKTVRRP
Subcellular Location(s) nucl 17, cyto_nucl 10.5, mito 8
Family & Domain DBs
Amino Acid Sequences MVQTATGKSPGLTAAWNKKSSTLPSTKAKLLAELKKQIAQKQKEAKEAAARAAACGGAPSTGKPATPAPTKPRMTPRALSAFSPTQLSSLQLRAPRTAPRSGAKAPPAPSCPLPGAKPKKVVPRSKVKAKPVPKTAPKKVAGKPKPKAPTPKKTVRRPAVSL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.36
3 0.38
4 0.38
5 0.41
6 0.44
7 0.45
8 0.46
9 0.42
10 0.42
11 0.48
12 0.52
13 0.51
14 0.51
15 0.46
16 0.45
17 0.46
18 0.47
19 0.47
20 0.49
21 0.48
22 0.49
23 0.51
24 0.5
25 0.52
26 0.49
27 0.51
28 0.55
29 0.57
30 0.59
31 0.58
32 0.55
33 0.52
34 0.49
35 0.41
36 0.35
37 0.3
38 0.23
39 0.22
40 0.19
41 0.11
42 0.1
43 0.08
44 0.05
45 0.06
46 0.06
47 0.09
48 0.09
49 0.09
50 0.11
51 0.13
52 0.17
53 0.21
54 0.25
55 0.28
56 0.36
57 0.38
58 0.41
59 0.47
60 0.48
61 0.48
62 0.45
63 0.44
64 0.42
65 0.41
66 0.37
67 0.32
68 0.28
69 0.24
70 0.24
71 0.19
72 0.13
73 0.12
74 0.13
75 0.11
76 0.11
77 0.13
78 0.15
79 0.16
80 0.17
81 0.19
82 0.23
83 0.25
84 0.26
85 0.27
86 0.27
87 0.31
88 0.32
89 0.35
90 0.34
91 0.35
92 0.35
93 0.36
94 0.37
95 0.34
96 0.32
97 0.3
98 0.28
99 0.26
100 0.26
101 0.32
102 0.37
103 0.39
104 0.45
105 0.48
106 0.56
107 0.62
108 0.68
109 0.66
110 0.69
111 0.72
112 0.76
113 0.79
114 0.78
115 0.78
116 0.78
117 0.8
118 0.79
119 0.81
120 0.8
121 0.82
122 0.82
123 0.81
124 0.79
125 0.77
126 0.75
127 0.76
128 0.76
129 0.76
130 0.75
131 0.75
132 0.77
133 0.77
134 0.81
135 0.8
136 0.81
137 0.8
138 0.84
139 0.84
140 0.87
141 0.9
142 0.89