Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A165CDU0

Protein Details
Accession A0A165CDU0    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
42-62RKPVSRPKTPVKRPAPRPPVVBasic
NLS Segment(s)
PositionSequence
40-83VARKPVSRPKTPVKRPAPRPPVVRKPTPVKRPVPVRTPIKRPTP
Subcellular Location(s) extr 19, mito 3, cyto 2, plas 2
Family & Domain DBs
Amino Acid Sequences MTAFRRIVLLAVLYLALLTSAVPVLDNDAPDAANLAARGVARKPVSRPKTPVKRPAPRPPVVRKPTPVKRPVPVRTPIKRPTP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.05
3 0.04
4 0.03
5 0.03
6 0.03
7 0.03
8 0.03
9 0.04
10 0.04
11 0.07
12 0.08
13 0.08
14 0.09
15 0.09
16 0.09
17 0.08
18 0.09
19 0.06
20 0.06
21 0.05
22 0.05
23 0.06
24 0.06
25 0.07
26 0.06
27 0.11
28 0.12
29 0.14
30 0.18
31 0.27
32 0.33
33 0.36
34 0.42
35 0.48
36 0.58
37 0.64
38 0.7
39 0.7
40 0.75
41 0.79
42 0.84
43 0.82
44 0.78
45 0.79
46 0.78
47 0.79
48 0.76
49 0.73
50 0.7
51 0.71
52 0.74
53 0.76
54 0.75
55 0.7
56 0.72
57 0.75
58 0.75
59 0.72
60 0.72
61 0.72
62 0.72
63 0.75