Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165R1Y4

Protein Details
Accession A0A165R1Y4    Localization Confidence Medium Confidence Score 14.7
NoLS Segment(s)
PositionSequenceProtein Nature
11-38TKPSGGGKSAKKKKWSKGKVKDKAQHAVBasic
NLS Segment(s)
PositionSequence
5-33KSKAAATKPSGGGKSAKKKKWSKGKVKDK
Subcellular Location(s) nucl 18, mito 5, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAPAKSKAAATKPSGGGKSAKKKKWSKGKVKDKAQHAVALDKPTFDRINKEVPTFRFISQSILIERLKIGGSLARKAIRHLEEEGQIKRIVHHNGQLIYTRSVGGAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.43
3 0.43
4 0.45
5 0.52
6 0.55
7 0.57
8 0.61
9 0.69
10 0.76
11 0.81
12 0.83
13 0.83
14 0.84
15 0.89
16 0.89
17 0.91
18 0.89
19 0.84
20 0.8
21 0.7
22 0.62
23 0.52
24 0.46
25 0.39
26 0.36
27 0.29
28 0.23
29 0.21
30 0.21
31 0.22
32 0.18
33 0.19
34 0.17
35 0.25
36 0.26
37 0.28
38 0.29
39 0.28
40 0.31
41 0.29
42 0.27
43 0.23
44 0.21
45 0.22
46 0.19
47 0.19
48 0.17
49 0.18
50 0.17
51 0.15
52 0.15
53 0.12
54 0.11
55 0.09
56 0.09
57 0.08
58 0.11
59 0.12
60 0.16
61 0.19
62 0.19
63 0.21
64 0.27
65 0.26
66 0.27
67 0.29
68 0.29
69 0.31
70 0.36
71 0.36
72 0.31
73 0.31
74 0.28
75 0.27
76 0.3
77 0.3
78 0.28
79 0.32
80 0.36
81 0.36
82 0.38
83 0.4
84 0.37
85 0.34
86 0.31
87 0.26