Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I2GVE8

Protein Details
Accession I2GVE8    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
98-129DERDQKIRNRNIKKKDTNKKSKKEGNKINEKQBasic
NLS Segment(s)
PositionSequence
103-125KIRNRNIKKKDTNKKSKKEGNKI
Subcellular Location(s) nucl 18, cyto_nucl 14.333, cyto 8.5, cyto_pero 5.166
Family & Domain DBs
InterPro View protein in InterPro  
IPR040357  Vma22/CCDC115  
Gene Ontology GO:0070072  P:vacuolar proton-transporting V-type ATPase complex assembly  
KEGG tbl:TBLA_0A03000  -  
Amino Acid Sequences MQDIYLELLKKLNDYDQSLDILQSNFKDGMYHLSRANYHNKDSLRGNYGEDYWDNTYEGHFTVNIDSKTNHISIAKKPLPKDNNEIIDQNEEEKSALDERDQKIRNRNIKKKDTNKKSKKEGNKINEKQSNKEEVNHEKKEDNYNKKEIMSGINKKTQEKIHKDTIYMFGGLNIPQSLRSCQTSFKNSIPTLEQLVNSRIEIAKICNELETIEIKNHGDK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.28
3 0.27
4 0.29
5 0.28
6 0.28
7 0.25
8 0.21
9 0.19
10 0.16
11 0.17
12 0.15
13 0.15
14 0.15
15 0.13
16 0.21
17 0.23
18 0.24
19 0.23
20 0.26
21 0.29
22 0.32
23 0.42
24 0.37
25 0.36
26 0.4
27 0.39
28 0.4
29 0.42
30 0.43
31 0.38
32 0.35
33 0.35
34 0.3
35 0.3
36 0.28
37 0.24
38 0.23
39 0.2
40 0.19
41 0.17
42 0.16
43 0.15
44 0.14
45 0.14
46 0.1
47 0.08
48 0.08
49 0.11
50 0.16
51 0.16
52 0.16
53 0.16
54 0.17
55 0.2
56 0.19
57 0.18
58 0.15
59 0.18
60 0.2
61 0.3
62 0.34
63 0.35
64 0.36
65 0.44
66 0.46
67 0.47
68 0.5
69 0.47
70 0.46
71 0.44
72 0.43
73 0.35
74 0.33
75 0.29
76 0.24
77 0.17
78 0.13
79 0.11
80 0.1
81 0.1
82 0.09
83 0.09
84 0.09
85 0.16
86 0.17
87 0.25
88 0.28
89 0.3
90 0.38
91 0.46
92 0.53
93 0.57
94 0.65
95 0.65
96 0.72
97 0.79
98 0.81
99 0.83
100 0.84
101 0.86
102 0.87
103 0.86
104 0.85
105 0.84
106 0.83
107 0.83
108 0.82
109 0.8
110 0.81
111 0.78
112 0.78
113 0.76
114 0.68
115 0.63
116 0.58
117 0.56
118 0.45
119 0.44
120 0.41
121 0.43
122 0.5
123 0.48
124 0.46
125 0.4
126 0.42
127 0.48
128 0.52
129 0.51
130 0.48
131 0.5
132 0.5
133 0.48
134 0.47
135 0.38
136 0.36
137 0.35
138 0.38
139 0.38
140 0.42
141 0.44
142 0.44
143 0.47
144 0.48
145 0.49
146 0.49
147 0.51
148 0.55
149 0.54
150 0.54
151 0.52
152 0.49
153 0.41
154 0.34
155 0.27
156 0.19
157 0.18
158 0.17
159 0.16
160 0.11
161 0.1
162 0.11
163 0.13
164 0.15
165 0.16
166 0.21
167 0.2
168 0.26
169 0.32
170 0.37
171 0.4
172 0.41
173 0.47
174 0.43
175 0.45
176 0.42
177 0.38
178 0.35
179 0.33
180 0.31
181 0.26
182 0.28
183 0.26
184 0.23
185 0.23
186 0.19
187 0.18
188 0.18
189 0.18
190 0.21
191 0.22
192 0.22
193 0.2
194 0.2
195 0.19
196 0.2
197 0.19
198 0.16
199 0.16
200 0.18