Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165BNL3

Protein Details
Accession A0A165BNL3    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
34-57QSSPNHPTMKKFRKRQRAARAEIVHydrophilic
NLS Segment(s)
PositionSequence
46-48RKR
Subcellular Location(s) nucl 13, cyto 5, cysk 4, cyto_mito 4
Family & Domain DBs
Pfam View protein in Pfam  
PF14223  Retrotran_gag_2  
Amino Acid Sequences LDDTNYHAWSYRMEMRLTKMDLWEIVSGEEEAPQSSPNHPTMKKFRKRQRAARAEIVLCVTESQHVHTKLDDPHEIWENLRLVHAPRGLGTRMTLRRQLYKMAYSEFLGMSAWVTSVQETVRRITDL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.33
3 0.39
4 0.4
5 0.36
6 0.3
7 0.28
8 0.27
9 0.26
10 0.23
11 0.17
12 0.14
13 0.13
14 0.12
15 0.11
16 0.11
17 0.09
18 0.08
19 0.08
20 0.09
21 0.1
22 0.11
23 0.15
24 0.18
25 0.24
26 0.25
27 0.31
28 0.41
29 0.5
30 0.58
31 0.64
32 0.7
33 0.75
34 0.83
35 0.86
36 0.87
37 0.86
38 0.82
39 0.79
40 0.74
41 0.63
42 0.55
43 0.45
44 0.34
45 0.24
46 0.18
47 0.1
48 0.08
49 0.08
50 0.09
51 0.14
52 0.15
53 0.15
54 0.15
55 0.19
56 0.19
57 0.23
58 0.22
59 0.17
60 0.19
61 0.22
62 0.22
63 0.18
64 0.2
65 0.17
66 0.16
67 0.15
68 0.14
69 0.12
70 0.16
71 0.17
72 0.13
73 0.14
74 0.16
75 0.17
76 0.17
77 0.17
78 0.21
79 0.25
80 0.28
81 0.33
82 0.33
83 0.39
84 0.4
85 0.45
86 0.41
87 0.41
88 0.4
89 0.37
90 0.36
91 0.3
92 0.3
93 0.23
94 0.19
95 0.15
96 0.12
97 0.1
98 0.08
99 0.07
100 0.06
101 0.06
102 0.06
103 0.08
104 0.09
105 0.13
106 0.15
107 0.18