Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A165Z160

Protein Details
Accession A0A165Z160    Localization Confidence High Confidence Score 16.9
NoLS Segment(s)
PositionSequenceProtein Nature
286-308DFDVPGKRSRKGKKQVKMTPEEEBasic
NLS Segment(s)
PositionSequence
143-152SKKRKRAGPK
198-199KR
291-324GKRSRKGKKQVKMTPEEEAAWKPRVYKWKFDRKR
Subcellular Location(s) nucl 18.5, cyto_nucl 13, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007144  SSU_processome_Utp11  
Gene Ontology GO:0005730  C:nucleolus  
GO:0032040  C:small-subunit processome  
GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF03998  Utp11  
Amino Acid Sequences ERGQLAHRTRLGILEKHKDYVLRARDYHSKQDRIHRLKEKAATRNQDEFYFGMVNQRTKDGVHVQERGNAVMPVDIVKVLKTQDGNYIRTVRAAGAKKIDALKTELGAITDLPAGDEWEDEDLSSQEKRALQEAGLLPGASGSKKRKRAGPKHLVFVESEEQARSLATPSAPVAQVEPVDEATDAADDLGWAIETKKKRKRDVVPTSSSTGQSAEGKDDDEGSKPKRHRSQVIKELAARLTRDRSLKFAERELEMQKLLMGKGAAKKLRGLEKDGAGKRDEDDEDDFDVPGKRSRKGKKQVKMTPEEEAAWKPRVYKWKFDRKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.48
3 0.47
4 0.48
5 0.43
6 0.42
7 0.45
8 0.45
9 0.42
10 0.41
11 0.44
12 0.53
13 0.56
14 0.63
15 0.62
16 0.62
17 0.61
18 0.69
19 0.75
20 0.73
21 0.78
22 0.77
23 0.74
24 0.73
25 0.76
26 0.74
27 0.72
28 0.73
29 0.72
30 0.69
31 0.71
32 0.65
33 0.58
34 0.51
35 0.43
36 0.37
37 0.3
38 0.23
39 0.23
40 0.24
41 0.26
42 0.25
43 0.26
44 0.24
45 0.22
46 0.27
47 0.26
48 0.31
49 0.34
50 0.38
51 0.37
52 0.41
53 0.42
54 0.38
55 0.33
56 0.25
57 0.19
58 0.15
59 0.14
60 0.1
61 0.09
62 0.09
63 0.08
64 0.08
65 0.1
66 0.1
67 0.12
68 0.13
69 0.13
70 0.22
71 0.26
72 0.28
73 0.3
74 0.33
75 0.3
76 0.3
77 0.29
78 0.21
79 0.25
80 0.26
81 0.25
82 0.25
83 0.25
84 0.27
85 0.3
86 0.3
87 0.24
88 0.24
89 0.22
90 0.19
91 0.19
92 0.16
93 0.13
94 0.12
95 0.1
96 0.08
97 0.08
98 0.07
99 0.06
100 0.06
101 0.06
102 0.06
103 0.06
104 0.05
105 0.06
106 0.06
107 0.05
108 0.06
109 0.06
110 0.07
111 0.08
112 0.08
113 0.09
114 0.11
115 0.12
116 0.14
117 0.14
118 0.12
119 0.18
120 0.18
121 0.17
122 0.15
123 0.14
124 0.12
125 0.12
126 0.12
127 0.07
128 0.11
129 0.17
130 0.24
131 0.32
132 0.34
133 0.41
134 0.52
135 0.61
136 0.68
137 0.71
138 0.68
139 0.67
140 0.66
141 0.6
142 0.49
143 0.42
144 0.33
145 0.23
146 0.19
147 0.13
148 0.11
149 0.1
150 0.1
151 0.07
152 0.06
153 0.06
154 0.06
155 0.06
156 0.07
157 0.09
158 0.09
159 0.09
160 0.08
161 0.08
162 0.08
163 0.08
164 0.08
165 0.06
166 0.07
167 0.07
168 0.06
169 0.05
170 0.05
171 0.04
172 0.04
173 0.03
174 0.03
175 0.03
176 0.03
177 0.03
178 0.03
179 0.04
180 0.08
181 0.14
182 0.23
183 0.31
184 0.39
185 0.45
186 0.55
187 0.63
188 0.7
189 0.76
190 0.76
191 0.75
192 0.71
193 0.68
194 0.61
195 0.51
196 0.41
197 0.3
198 0.23
199 0.19
200 0.16
201 0.15
202 0.13
203 0.14
204 0.13
205 0.14
206 0.13
207 0.14
208 0.18
209 0.2
210 0.26
211 0.29
212 0.38
213 0.45
214 0.5
215 0.57
216 0.62
217 0.69
218 0.72
219 0.76
220 0.71
221 0.64
222 0.61
223 0.55
224 0.47
225 0.38
226 0.32
227 0.28
228 0.29
229 0.32
230 0.29
231 0.3
232 0.35
233 0.4
234 0.4
235 0.4
236 0.39
237 0.37
238 0.39
239 0.38
240 0.34
241 0.26
242 0.24
243 0.2
244 0.19
245 0.17
246 0.15
247 0.13
248 0.14
249 0.19
250 0.27
251 0.28
252 0.27
253 0.31
254 0.35
255 0.43
256 0.42
257 0.43
258 0.41
259 0.44
260 0.53
261 0.53
262 0.5
263 0.43
264 0.41
265 0.36
266 0.36
267 0.31
268 0.25
269 0.25
270 0.25
271 0.27
272 0.26
273 0.25
274 0.22
275 0.24
276 0.22
277 0.25
278 0.26
279 0.28
280 0.37
281 0.47
282 0.56
283 0.64
284 0.73
285 0.76
286 0.83
287 0.87
288 0.87
289 0.86
290 0.78
291 0.74
292 0.67
293 0.6
294 0.52
295 0.48
296 0.43
297 0.38
298 0.36
299 0.32
300 0.36
301 0.44
302 0.45
303 0.51
304 0.56