Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165C303

Protein Details
Accession A0A165C303    Localization Confidence Medium Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
102-121PSPTKPKKAFTKSKGRKTRSBasic
NLS Segment(s)
PositionSequence
99-120RRPPSPTKPKKAFTKSKGRKTR
Subcellular Location(s) nucl 15cyto_nucl 15, cyto 11
Family & Domain DBs
InterPro View protein in InterPro  
IPR013924  RNase_H2_suC  
Gene Ontology GO:0032299  C:ribonuclease H2 complex  
GO:0006401  P:RNA catabolic process  
Pfam View protein in Pfam  
PF08615  RNase_H2_suC  
CDD cd09271  RNase_H2-C  
Amino Acid Sequences MSDATLSIKPSGPLPDASPSLMPFHIAHTGPAPLSTYFRVKTTPAGVAEDGTPTRERHVASFRGRTVEGTRVALPEGYVGLVLQSDAQASTLTASSHARRPPSPTKPKKAFTKSKGRKTRSSTVRDEPEPEPEPVEAMPDAMDLDAPLPADEASLDVEIPADAVATRQLTPAGKFDSFLVWGADYAVDEGFDDYIRSLKEWTSLAAEV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.26
3 0.26
4 0.27
5 0.26
6 0.23
7 0.24
8 0.22
9 0.21
10 0.16
11 0.18
12 0.21
13 0.2
14 0.2
15 0.18
16 0.2
17 0.17
18 0.18
19 0.17
20 0.13
21 0.15
22 0.17
23 0.21
24 0.2
25 0.21
26 0.23
27 0.22
28 0.25
29 0.25
30 0.27
31 0.23
32 0.25
33 0.24
34 0.23
35 0.23
36 0.21
37 0.18
38 0.15
39 0.16
40 0.13
41 0.15
42 0.17
43 0.18
44 0.19
45 0.25
46 0.3
47 0.34
48 0.4
49 0.39
50 0.39
51 0.39
52 0.37
53 0.33
54 0.31
55 0.27
56 0.23
57 0.23
58 0.2
59 0.2
60 0.18
61 0.15
62 0.1
63 0.08
64 0.06
65 0.05
66 0.04
67 0.04
68 0.03
69 0.03
70 0.03
71 0.03
72 0.03
73 0.03
74 0.04
75 0.04
76 0.04
77 0.04
78 0.05
79 0.05
80 0.06
81 0.08
82 0.1
83 0.14
84 0.17
85 0.19
86 0.19
87 0.26
88 0.34
89 0.42
90 0.52
91 0.56
92 0.63
93 0.68
94 0.74
95 0.76
96 0.77
97 0.76
98 0.72
99 0.75
100 0.75
101 0.79
102 0.82
103 0.78
104 0.77
105 0.75
106 0.77
107 0.75
108 0.72
109 0.68
110 0.65
111 0.65
112 0.58
113 0.55
114 0.46
115 0.44
116 0.39
117 0.33
118 0.27
119 0.21
120 0.21
121 0.16
122 0.17
123 0.1
124 0.08
125 0.07
126 0.06
127 0.06
128 0.05
129 0.05
130 0.04
131 0.04
132 0.04
133 0.04
134 0.04
135 0.05
136 0.04
137 0.05
138 0.05
139 0.05
140 0.06
141 0.06
142 0.06
143 0.05
144 0.05
145 0.05
146 0.05
147 0.05
148 0.03
149 0.03
150 0.04
151 0.06
152 0.07
153 0.08
154 0.08
155 0.11
156 0.13
157 0.15
158 0.18
159 0.21
160 0.2
161 0.2
162 0.21
163 0.21
164 0.2
165 0.2
166 0.17
167 0.12
168 0.12
169 0.12
170 0.11
171 0.09
172 0.09
173 0.08
174 0.06
175 0.06
176 0.07
177 0.07
178 0.07
179 0.07
180 0.07
181 0.1
182 0.11
183 0.11
184 0.12
185 0.13
186 0.16
187 0.17
188 0.18