Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165QE73

Protein Details
Accession A0A165QE73   
Localization Confidence Low
Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
22-47ALYVLITRRSKRKRNRTRNASVNAWTHydrophilic
NLS Segment(s)
PositionSequence
30-37RSKRKRNR
Subcellular Location(s) extr 21, E.R. 3, nucl 1, mito 1, golg 1, mito_nucl 1
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MPQNRVTIIALVLGLSSLALFALYVLITRRSKRKRNRTRNASVNAWTMNTIQENSYVTADPAPPTAPEKDTASAVRSSDETPIDNHAYGGSLEPSNNRTPTADRLSDDSYFFRSIRSIHAWAHGQPKTTFIDLYKCNHFYTTSSYTVDCRDESCVNSGQDTSHGDPDLDAMSDNQRYTVHHVHATICGACKIDTRTIDAGKSEKARL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.05
3 0.04
4 0.03
5 0.03
6 0.03
7 0.03
8 0.03
9 0.03
10 0.03
11 0.04
12 0.06
13 0.13
14 0.16
15 0.21
16 0.31
17 0.41
18 0.51
19 0.61
20 0.71
21 0.77
22 0.85
23 0.92
24 0.92
25 0.93
26 0.92
27 0.88
28 0.82
29 0.74
30 0.67
31 0.56
32 0.46
33 0.37
34 0.28
35 0.23
36 0.19
37 0.16
38 0.12
39 0.13
40 0.14
41 0.14
42 0.15
43 0.13
44 0.12
45 0.13
46 0.13
47 0.12
48 0.12
49 0.11
50 0.1
51 0.13
52 0.14
53 0.14
54 0.15
55 0.17
56 0.17
57 0.19
58 0.19
59 0.19
60 0.18
61 0.17
62 0.16
63 0.14
64 0.14
65 0.15
66 0.14
67 0.13
68 0.12
69 0.16
70 0.16
71 0.15
72 0.14
73 0.12
74 0.11
75 0.11
76 0.1
77 0.08
78 0.07
79 0.07
80 0.08
81 0.11
82 0.13
83 0.13
84 0.13
85 0.13
86 0.15
87 0.2
88 0.23
89 0.22
90 0.2
91 0.23
92 0.25
93 0.24
94 0.24
95 0.19
96 0.17
97 0.17
98 0.17
99 0.14
100 0.12
101 0.12
102 0.15
103 0.18
104 0.18
105 0.17
106 0.2
107 0.21
108 0.24
109 0.31
110 0.28
111 0.27
112 0.24
113 0.26
114 0.25
115 0.24
116 0.22
117 0.15
118 0.2
119 0.2
120 0.24
121 0.27
122 0.26
123 0.26
124 0.26
125 0.26
126 0.21
127 0.26
128 0.27
129 0.24
130 0.24
131 0.24
132 0.24
133 0.26
134 0.26
135 0.19
136 0.15
137 0.17
138 0.18
139 0.19
140 0.21
141 0.23
142 0.22
143 0.22
144 0.22
145 0.18
146 0.19
147 0.22
148 0.21
149 0.19
150 0.19
151 0.18
152 0.17
153 0.18
154 0.16
155 0.12
156 0.1
157 0.08
158 0.12
159 0.14
160 0.14
161 0.14
162 0.14
163 0.16
164 0.23
165 0.28
166 0.28
167 0.29
168 0.3
169 0.31
170 0.33
171 0.34
172 0.28
173 0.23
174 0.21
175 0.19
176 0.18
177 0.21
178 0.22
179 0.26
180 0.26
181 0.3
182 0.34
183 0.35
184 0.37
185 0.36
186 0.34
187 0.34