Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165M4T2

Protein Details
Accession A0A165M4T2    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
41-62LLQRQWRSLRWRRRRLWKWGLLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 24, cyto 2
Family & Domain DBs
Amino Acid Sequences MRSVRRCCCCRRGGWIHRIVLRRRWWWCVLRVWWRRRFQWLLQRQWRSLRWRRRRLWKWGLLIDYQGMGRASLSATTVPGASAPVTPLYAELHKFSCIAVSWLHMRRLQQA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.74
3 0.7
4 0.7
5 0.73
6 0.68
7 0.65
8 0.63
9 0.6
10 0.57
11 0.57
12 0.57
13 0.55
14 0.55
15 0.54
16 0.54
17 0.57
18 0.62
19 0.66
20 0.68
21 0.69
22 0.66
23 0.66
24 0.64
25 0.61
26 0.62
27 0.62
28 0.64
29 0.67
30 0.69
31 0.63
32 0.64
33 0.62
34 0.61
35 0.61
36 0.62
37 0.63
38 0.69
39 0.74
40 0.8
41 0.82
42 0.82
43 0.83
44 0.79
45 0.73
46 0.67
47 0.61
48 0.5
49 0.43
50 0.33
51 0.24
52 0.17
53 0.13
54 0.09
55 0.07
56 0.06
57 0.06
58 0.06
59 0.05
60 0.06
61 0.05
62 0.06
63 0.06
64 0.06
65 0.06
66 0.06
67 0.06
68 0.06
69 0.06
70 0.07
71 0.07
72 0.08
73 0.08
74 0.08
75 0.1
76 0.12
77 0.14
78 0.15
79 0.16
80 0.17
81 0.17
82 0.16
83 0.15
84 0.13
85 0.14
86 0.12
87 0.14
88 0.21
89 0.26
90 0.3
91 0.3