Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165JQP5

Protein Details
Accession A0A165JQP5   
Localization Confidence Medium
Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
15-57GDEYQPSQRKRKRRHGFLARKKTKGGRKILARRLKKKREFLTHBasic
NLS Segment(s)
PositionSequence
23-52RKRKRRHGFLARKKTKGGRKILARRLKKKR
Subcellular Location(s) mito 13, nucl 8, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000271  Ribosomal_L34  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00468  Ribosomal_L34  
Amino Acid Sequences MALPAMQQVRCMSRGDEYQPSQRKRKRRHGFLARKKTKGGRKILARRLKKKREFLTH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.27
3 0.31
4 0.31
5 0.39
6 0.46
7 0.51
8 0.57
9 0.6
10 0.65
11 0.68
12 0.76
13 0.77
14 0.78
15 0.83
16 0.84
17 0.89
18 0.9
19 0.92
20 0.88
21 0.8
22 0.75
23 0.72
24 0.69
25 0.67
26 0.64
27 0.61
28 0.65
29 0.72
30 0.78
31 0.8
32 0.82
33 0.84
34 0.87
35 0.89
36 0.88
37 0.88