Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165BE47

Protein Details
Accession A0A165BE47   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
109-133LLCKAGERSRRIRRARSNLRPRGLHHydrophilic
NLS Segment(s)
PositionSequence
115-131ERSRRIRRARSNLRPRG
Subcellular Location(s) extr 12, mito 8.5, cyto_mito 6.5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MLTRYFWHGLFCTWIPYLFWASEQQDVPVFCSMIRARCSFSSERLCSVLAQLREPGTVQSGASSHSLFLVLSRPAYDWVCGGCAPLCSVQVPFASVRQGGKGEGKGMNLLCKAGERSRRIRRARSNLRPRGLH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.19
3 0.2
4 0.21
5 0.16
6 0.17
7 0.18
8 0.19
9 0.23
10 0.23
11 0.22
12 0.22
13 0.22
14 0.23
15 0.2
16 0.18
17 0.13
18 0.19
19 0.19
20 0.21
21 0.24
22 0.23
23 0.25
24 0.26
25 0.32
26 0.28
27 0.32
28 0.36
29 0.34
30 0.35
31 0.33
32 0.32
33 0.27
34 0.28
35 0.26
36 0.18
37 0.17
38 0.17
39 0.16
40 0.16
41 0.16
42 0.13
43 0.1
44 0.1
45 0.09
46 0.08
47 0.07
48 0.09
49 0.09
50 0.09
51 0.07
52 0.07
53 0.07
54 0.06
55 0.06
56 0.07
57 0.06
58 0.06
59 0.07
60 0.07
61 0.09
62 0.1
63 0.1
64 0.08
65 0.08
66 0.09
67 0.09
68 0.09
69 0.08
70 0.07
71 0.08
72 0.09
73 0.09
74 0.08
75 0.09
76 0.1
77 0.1
78 0.11
79 0.1
80 0.11
81 0.12
82 0.13
83 0.13
84 0.13
85 0.14
86 0.14
87 0.18
88 0.18
89 0.2
90 0.2
91 0.2
92 0.22
93 0.21
94 0.24
95 0.2
96 0.2
97 0.16
98 0.17
99 0.2
100 0.24
101 0.32
102 0.34
103 0.44
104 0.54
105 0.64
106 0.7
107 0.76
108 0.8
109 0.83
110 0.87
111 0.89
112 0.89
113 0.89