Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A166MAX0

Protein Details
Accession A0A166MAX0    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
87-106KEVAVRRRMHKDFNKRKEDFBasic
NLS Segment(s)
Subcellular Location(s) nucl 16.5, cyto_nucl 12.5, cyto 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR015877  Cdk-activating_kinase_MAT1_cen  
IPR004575  MAT1/Tfb3  
IPR001841  Znf_RING  
IPR013083  Znf_RING/FYVE/PHD  
IPR017907  Znf_RING_CS  
Gene Ontology GO:0005675  C:transcription factor TFIIH holo complex  
GO:0061575  F:cyclin-dependent protein serine/threonine kinase activator activity  
GO:0046872  F:metal ion binding  
GO:0006289  P:nucleotide-excision repair  
GO:0045737  P:positive regulation of cyclin-dependent protein serine/threonine kinase activity  
Pfam View protein in Pfam  
PF06391  MAT1  
PF17121  zf-C3HC4_5  
PROSITE View protein in PROSITE  
PS00518  ZF_RING_1  
PS50089  ZF_RING_2  
Amino Acid Sequences MFSGGVKDSTGKTQEYSSQDDQCPVCKSDRYLNPKLRLLVSSCYHKMCESCIDRLFTLGPAPCPVCSKILRKMAFAPQTFEDLTVEKEVAVRRRMHKDFNKRKEDFIDLKSYNDYLEWVEEL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.31
3 0.37
4 0.36
5 0.39
6 0.39
7 0.42
8 0.41
9 0.38
10 0.37
11 0.32
12 0.3
13 0.27
14 0.3
15 0.34
16 0.42
17 0.46
18 0.52
19 0.59
20 0.61
21 0.63
22 0.61
23 0.53
24 0.46
25 0.4
26 0.37
27 0.32
28 0.32
29 0.3
30 0.29
31 0.28
32 0.27
33 0.25
34 0.21
35 0.26
36 0.22
37 0.24
38 0.25
39 0.26
40 0.25
41 0.26
42 0.24
43 0.16
44 0.16
45 0.12
46 0.1
47 0.1
48 0.11
49 0.1
50 0.12
51 0.13
52 0.14
53 0.17
54 0.21
55 0.27
56 0.35
57 0.35
58 0.35
59 0.37
60 0.41
61 0.45
62 0.41
63 0.37
64 0.29
65 0.31
66 0.3
67 0.27
68 0.2
69 0.14
70 0.15
71 0.13
72 0.12
73 0.09
74 0.11
75 0.15
76 0.19
77 0.23
78 0.27
79 0.32
80 0.42
81 0.45
82 0.53
83 0.59
84 0.66
85 0.72
86 0.77
87 0.81
88 0.73
89 0.74
90 0.69
91 0.68
92 0.62
93 0.56
94 0.55
95 0.46
96 0.46
97 0.44
98 0.39
99 0.31
100 0.25
101 0.22
102 0.14