Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165DV75

Protein Details
Accession A0A165DV75   
Localization Confidence Low
Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
312-340LRAAKDREERDRKSKPKGIRIRNPVDTSTHydrophilic
NLS Segment(s)
PositionSequence
312-332LRAAKDREERDRKSKPKGIRI
Subcellular Location(s) cyto 13.5, cyto_nucl 10.333, cyto_mito 9.666, nucl 5, mito 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004130  Gpn  
IPR030231  Gpn2  
IPR027417  P-loop_NTPase  
Gene Ontology GO:0005525  F:GTP binding  
GO:0016787  F:hydrolase activity  
Pfam View protein in Pfam  
PF03029  ATP_bind_1  
CDD cd17871  GPN2  
Amino Acid Sequences MPFGEVVVGSPGSGKSTYAYGKHQLFTALERPISVVNLDPANDALPYPCAIDISELITLQDVMDEHALGPNGAMLFCLEHLEANFDWLEQRLVELGENAYVVFDLPGQVELSTNHDSLRNIVRRLVKLGFRLCAVHLCDAHYVTTAANYVAVLLLSLRAMMQLELPHINVLSKVDLITKYGELEFNLDFYTEVQDLSYLSNSLQQSAPRFAELNQRICSLIEDYSLVGFETLAVEDKESMLHLTRVIDRATGYIFTPKGTAYGDAYAMFTTAAGPLQDPGADVHAVQERWVDHRAEYDEFEKGQWRREGEALRAAKDREERDRKSKPKGIRIRNPVDTSTVQT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.11
3 0.16
4 0.2
5 0.22
6 0.27
7 0.33
8 0.37
9 0.37
10 0.37
11 0.35
12 0.32
13 0.34
14 0.34
15 0.3
16 0.26
17 0.25
18 0.26
19 0.24
20 0.23
21 0.19
22 0.15
23 0.14
24 0.15
25 0.15
26 0.15
27 0.14
28 0.14
29 0.13
30 0.12
31 0.09
32 0.09
33 0.09
34 0.1
35 0.09
36 0.09
37 0.09
38 0.11
39 0.11
40 0.12
41 0.12
42 0.11
43 0.11
44 0.11
45 0.11
46 0.08
47 0.09
48 0.06
49 0.07
50 0.07
51 0.08
52 0.07
53 0.09
54 0.1
55 0.08
56 0.08
57 0.08
58 0.08
59 0.07
60 0.07
61 0.05
62 0.06
63 0.06
64 0.08
65 0.07
66 0.07
67 0.07
68 0.11
69 0.1
70 0.12
71 0.11
72 0.1
73 0.11
74 0.11
75 0.11
76 0.07
77 0.08
78 0.07
79 0.07
80 0.08
81 0.08
82 0.08
83 0.07
84 0.07
85 0.07
86 0.06
87 0.05
88 0.05
89 0.04
90 0.04
91 0.04
92 0.05
93 0.05
94 0.06
95 0.06
96 0.07
97 0.07
98 0.12
99 0.15
100 0.14
101 0.14
102 0.16
103 0.16
104 0.19
105 0.27
106 0.26
107 0.24
108 0.29
109 0.34
110 0.33
111 0.37
112 0.38
113 0.32
114 0.33
115 0.34
116 0.3
117 0.26
118 0.26
119 0.22
120 0.23
121 0.21
122 0.18
123 0.16
124 0.17
125 0.17
126 0.17
127 0.16
128 0.13
129 0.11
130 0.08
131 0.09
132 0.07
133 0.06
134 0.06
135 0.05
136 0.05
137 0.04
138 0.04
139 0.03
140 0.03
141 0.03
142 0.03
143 0.03
144 0.03
145 0.03
146 0.03
147 0.03
148 0.05
149 0.05
150 0.06
151 0.07
152 0.07
153 0.07
154 0.07
155 0.07
156 0.06
157 0.06
158 0.06
159 0.05
160 0.05
161 0.07
162 0.07
163 0.08
164 0.09
165 0.09
166 0.09
167 0.09
168 0.09
169 0.08
170 0.1
171 0.09
172 0.08
173 0.08
174 0.07
175 0.07
176 0.07
177 0.09
178 0.07
179 0.07
180 0.06
181 0.06
182 0.07
183 0.07
184 0.07
185 0.05
186 0.05
187 0.11
188 0.11
189 0.12
190 0.13
191 0.14
192 0.17
193 0.2
194 0.2
195 0.16
196 0.17
197 0.16
198 0.26
199 0.29
200 0.32
201 0.29
202 0.3
203 0.29
204 0.29
205 0.29
206 0.2
207 0.16
208 0.11
209 0.1
210 0.09
211 0.09
212 0.09
213 0.07
214 0.05
215 0.05
216 0.04
217 0.04
218 0.04
219 0.05
220 0.05
221 0.06
222 0.06
223 0.06
224 0.06
225 0.06
226 0.07
227 0.07
228 0.08
229 0.08
230 0.1
231 0.13
232 0.15
233 0.15
234 0.14
235 0.14
236 0.14
237 0.14
238 0.13
239 0.11
240 0.14
241 0.14
242 0.14
243 0.14
244 0.13
245 0.13
246 0.13
247 0.14
248 0.11
249 0.13
250 0.13
251 0.13
252 0.13
253 0.12
254 0.11
255 0.09
256 0.07
257 0.06
258 0.06
259 0.06
260 0.05
261 0.06
262 0.06
263 0.07
264 0.07
265 0.07
266 0.07
267 0.09
268 0.09
269 0.09
270 0.11
271 0.16
272 0.16
273 0.15
274 0.18
275 0.16
276 0.2
277 0.23
278 0.22
279 0.17
280 0.22
281 0.26
282 0.25
283 0.27
284 0.26
285 0.25
286 0.25
287 0.25
288 0.28
289 0.26
290 0.31
291 0.33
292 0.34
293 0.34
294 0.4
295 0.43
296 0.4
297 0.47
298 0.43
299 0.42
300 0.44
301 0.41
302 0.4
303 0.43
304 0.44
305 0.46
306 0.53
307 0.56
308 0.62
309 0.72
310 0.75
311 0.78
312 0.81
313 0.8
314 0.81
315 0.84
316 0.85
317 0.85
318 0.87
319 0.86
320 0.87
321 0.82
322 0.73
323 0.68