Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165DSE3

Protein Details
Accession A0A165DSE3    Localization Confidence Medium Confidence Score 14.1
NoLS Segment(s)
PositionSequenceProtein Nature
94-113FSAFVKRKPKPAPERTRARLHydrophilic
NLS Segment(s)
PositionSequence
99-112KRKPKPAPERTRAR
Subcellular Location(s) nucl 23, cyto_nucl 14.5
Family & Domain DBs
Amino Acid Sequences MKPSLLASASTDSLPDLIPFDQSLADEMESRMASPRRVPYRPMSHPYLIRMGQVCSFDHALPIPPNANPFAHNPRVASYIQARDTGFTAALDDFSAFVKRKPKPAPERTRARL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.11
3 0.09
4 0.09
5 0.1
6 0.1
7 0.1
8 0.1
9 0.09
10 0.1
11 0.09
12 0.1
13 0.09
14 0.09
15 0.11
16 0.11
17 0.11
18 0.15
19 0.16
20 0.16
21 0.2
22 0.28
23 0.33
24 0.35
25 0.38
26 0.41
27 0.49
28 0.54
29 0.55
30 0.52
31 0.49
32 0.49
33 0.47
34 0.43
35 0.35
36 0.3
37 0.25
38 0.21
39 0.19
40 0.19
41 0.16
42 0.13
43 0.14
44 0.12
45 0.12
46 0.11
47 0.11
48 0.1
49 0.11
50 0.1
51 0.09
52 0.11
53 0.12
54 0.12
55 0.12
56 0.16
57 0.22
58 0.25
59 0.26
60 0.25
61 0.25
62 0.28
63 0.26
64 0.24
65 0.22
66 0.24
67 0.24
68 0.27
69 0.25
70 0.23
71 0.24
72 0.22
73 0.17
74 0.12
75 0.12
76 0.09
77 0.09
78 0.09
79 0.08
80 0.07
81 0.08
82 0.12
83 0.11
84 0.15
85 0.24
86 0.27
87 0.36
88 0.44
89 0.54
90 0.61
91 0.71
92 0.79
93 0.8