FuNGI

A0A165P249

Protein Details

Accession

A0A165P249

Localization Confidence

Low

Confidence Score

7.7

NoLS Segment(s)

Position	Sequence	Protein Nature
352-376	QASVTSRGRTRSRRPLARRSLPLSQ	Hydrophilic

NLS Segment(s)

Subcellular Location(s)

mito 19, nucl 7

Family & Domain DBs

Amino Acid Sequences

MLQTMRPALTLMLPTPVSNPTPSRAAAGARRARSPHPHARLAARVRGSSCTPPPMLPQPCGTADGDLDGIGEPMMFEMSPIVATRGIESLAPVASMPVPVPGPLRVPFPPRAPLFAGYDSGLRRQPAVADSPPVDGAQLDAVPALRKSRPATALQPAANIFPRTASITAHYTVPATPTGKPPSFRYNLPAYYRTSVQANSSTMTSAPVPPALATATAGTVFLEDELYEEDEQQAQDVPELVHHAHDCLQCSVSGSHQHHLHANMRRVVSHTSARTLAPPYGLGAGARRRSSTPDAFKLEMLAYQQQEAQLQMTSSSEDDVPITPDHAFPDDTDGEREEDVLSMRRARTHSPQASVTSRGRTRSRRPLARRSLPLSQQMRELVLTSPSSSGGNDGDRDDEFGSDYEHNIRRRSG

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.18
2	0.2
3	0.22
4	0.21
5	0.23
6	0.25
7	0.24
8	0.27
9	0.28
10	0.28
11	0.27
12	0.3
13	0.33
14	0.4
15	0.45
16	0.44
17	0.48
18	0.49
19	0.53
20	0.57
21	0.6
22	0.61
23	0.6
24	0.63
25	0.62
26	0.65
27	0.68
28	0.64
29	0.62
30	0.55
31	0.51
32	0.46
33	0.46
34	0.44
35	0.42
36	0.4
37	0.38
38	0.36
39	0.35
40	0.38
41	0.44
42	0.44
43	0.4
44	0.39
45	0.37
46	0.37
47	0.38
48	0.33
49	0.25
50	0.21
51	0.19
52	0.17
53	0.12
54	0.11
55	0.08
56	0.08
57	0.06
58	0.06
59	0.04
60	0.04
61	0.05
62	0.04
63	0.04
64	0.04
65	0.05
66	0.05
67	0.06
68	0.07
69	0.08
70	0.08
71	0.09
72	0.1
73	0.1
74	0.09
75	0.09
76	0.09
77	0.08
78	0.08
79	0.07
80	0.07
81	0.07
82	0.07
83	0.07
84	0.07
85	0.08
86	0.08
87	0.1
88	0.1
89	0.13
90	0.14
91	0.18
92	0.19
93	0.24
94	0.28
95	0.3
96	0.36
97	0.34
98	0.36
99	0.35
100	0.35
101	0.33
102	0.3
103	0.28
104	0.22
105	0.24
106	0.21
107	0.21
108	0.21
109	0.17
110	0.17
111	0.15
112	0.16
113	0.16
114	0.2
115	0.18
116	0.19
117	0.19
118	0.2
119	0.2
120	0.18
121	0.16
122	0.11
123	0.1
124	0.08
125	0.07
126	0.05
127	0.05
128	0.06
129	0.06
130	0.07
131	0.1
132	0.1
133	0.13
134	0.16
135	0.21
136	0.24
137	0.27
138	0.31
139	0.34
140	0.39
141	0.35
142	0.35
143	0.3
144	0.28
145	0.27
146	0.23
147	0.17
148	0.11
149	0.12
150	0.13
151	0.13
152	0.11
153	0.11
154	0.13
155	0.14
156	0.14
157	0.14
158	0.12
159	0.12
160	0.13
161	0.12
162	0.12
163	0.12
164	0.17
165	0.23
166	0.24
167	0.26
168	0.28
169	0.33
170	0.35
171	0.34
172	0.33
173	0.33
174	0.36
175	0.38
176	0.37
177	0.32
178	0.31
179	0.31
180	0.27
181	0.23
182	0.19
183	0.17
184	0.17
185	0.15
186	0.14
187	0.13
188	0.12
189	0.11
190	0.11
191	0.1
192	0.08
193	0.08
194	0.07
195	0.07
196	0.07
197	0.07
198	0.06
199	0.06
200	0.05
201	0.05
202	0.05
203	0.05
204	0.05
205	0.04
206	0.04
207	0.04
208	0.04
209	0.03
210	0.03
211	0.04
212	0.04
213	0.06
214	0.06
215	0.06
216	0.07
217	0.08
218	0.08
219	0.07
220	0.08
221	0.06
222	0.06
223	0.07
224	0.07
225	0.06
226	0.08
227	0.08
228	0.08
229	0.08
230	0.09
231	0.13
232	0.15
233	0.16
234	0.15
235	0.16
236	0.14
237	0.16
238	0.16
239	0.13
240	0.2
241	0.2
242	0.24
243	0.25
244	0.26
245	0.27
246	0.3
247	0.35
248	0.34
249	0.37
250	0.37
251	0.36
252	0.35
253	0.35
254	0.34
255	0.31
256	0.3
257	0.25
258	0.24
259	0.25
260	0.25
261	0.25
262	0.24
263	0.21
264	0.16
265	0.15
266	0.13
267	0.12
268	0.12
269	0.1
270	0.12
271	0.17
272	0.21
273	0.22
274	0.22
275	0.22
276	0.28
277	0.34
278	0.38
279	0.4
280	0.42
281	0.46
282	0.46
283	0.45
284	0.41
285	0.35
286	0.28
287	0.23
288	0.2
289	0.16
290	0.15
291	0.16
292	0.16
293	0.16
294	0.15
295	0.14
296	0.1
297	0.1
298	0.09
299	0.09
300	0.09
301	0.09
302	0.09
303	0.08
304	0.08
305	0.09
306	0.09
307	0.11
308	0.11
309	0.12
310	0.11
311	0.12
312	0.13
313	0.14
314	0.14
315	0.12
316	0.18
317	0.18
318	0.19
319	0.2
320	0.2
321	0.19
322	0.19
323	0.19
324	0.13
325	0.12
326	0.12
327	0.14
328	0.15
329	0.18
330	0.19
331	0.24
332	0.26
333	0.3
334	0.38
335	0.45
336	0.48
337	0.48
338	0.51
339	0.52
340	0.53
341	0.54
342	0.49
343	0.47
344	0.45
345	0.47
346	0.52
347	0.55
348	0.62
349	0.67
350	0.73
351	0.75
352	0.8
353	0.85
354	0.87
355	0.88
356	0.86
357	0.82
358	0.8
359	0.75
360	0.76
361	0.7
362	0.61
363	0.56
364	0.49
365	0.45
366	0.36
367	0.32
368	0.24
369	0.22
370	0.21
371	0.18
372	0.17
373	0.16
374	0.16
375	0.15
376	0.16
377	0.15
378	0.17
379	0.17
380	0.17
381	0.19
382	0.19
383	0.21
384	0.2
385	0.17
386	0.16
387	0.15
388	0.17
389	0.16
390	0.18
391	0.23
392	0.29
393	0.33

A0A165P249

3D AlphaFold-predicted Structure Viewer