Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165Z4T2

Protein Details
Accession A0A165Z4T2   
Localization Confidence Medium
Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
20-45VKHVSRSCQECRRRKVKCNGVTPKCSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 25.5, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS00463  ZN2_CY6_FUNGAL_1  
PS50048  ZN2_CY6_FUNGAL_2  
CDD cd00067  GAL4  
Amino Acid Sequences MHIPPETSNRRTSRDSGRRVKHVSRSCQECRRRKVKCNGVTPKCSGCIDRRVACDYSGEPDRRHTRRLMQALKTSNERQEARIQQLLNYLENLGAPIPPAPESSPEPETRGVAEAVQRRGDA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.66
3 0.68
4 0.71
5 0.74
6 0.76
7 0.77
8 0.76
9 0.75
10 0.74
11 0.72
12 0.73
13 0.72
14 0.75
15 0.78
16 0.77
17 0.78
18 0.79
19 0.79
20 0.8
21 0.83
22 0.84
23 0.82
24 0.83
25 0.84
26 0.81
27 0.78
28 0.71
29 0.63
30 0.55
31 0.47
32 0.39
33 0.32
34 0.32
35 0.33
36 0.33
37 0.34
38 0.35
39 0.35
40 0.32
41 0.3
42 0.23
43 0.21
44 0.23
45 0.22
46 0.19
47 0.24
48 0.32
49 0.33
50 0.35
51 0.33
52 0.35
53 0.41
54 0.5
55 0.5
56 0.47
57 0.51
58 0.53
59 0.53
60 0.51
61 0.45
62 0.39
63 0.39
64 0.36
65 0.32
66 0.36
67 0.37
68 0.37
69 0.39
70 0.36
71 0.3
72 0.35
73 0.34
74 0.26
75 0.23
76 0.18
77 0.14
78 0.14
79 0.13
80 0.08
81 0.06
82 0.06
83 0.06
84 0.07
85 0.08
86 0.1
87 0.1
88 0.14
89 0.18
90 0.23
91 0.26
92 0.26
93 0.29
94 0.29
95 0.29
96 0.27
97 0.25
98 0.2
99 0.18
100 0.23
101 0.27
102 0.29