Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165DIH7

Protein Details
Accession A0A165DIH7   
Localization Confidence Medium
Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
46-75NTWPERKRQALQERRRKREERSKQADATKLHydrophilic
NLS Segment(s)
PositionSequence
52-68KRQALQERRRKREERSK
Subcellular Location(s) nucl 20.5, cyto_nucl 12, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR019406  APLF_PBZ  
Pfam View protein in Pfam  
PF10283  zf-CCHH  
Amino Acid Sequences MVEASLWLWWSIVKEQATSEDCWYGLDCRKQTDPDHVFRFNHVCLNTWPERKRQALQERRRKREERSKQADATKL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.17
3 0.23
4 0.25
5 0.24
6 0.24
7 0.19
8 0.19
9 0.18
10 0.19
11 0.17
12 0.19
13 0.23
14 0.22
15 0.25
16 0.27
17 0.3
18 0.3
19 0.37
20 0.37
21 0.37
22 0.41
23 0.41
24 0.39
25 0.38
26 0.39
27 0.29
28 0.29
29 0.22
30 0.2
31 0.18
32 0.24
33 0.28
34 0.33
35 0.34
36 0.35
37 0.41
38 0.44
39 0.47
40 0.5
41 0.55
42 0.59
43 0.68
44 0.73
45 0.78
46 0.82
47 0.88
48 0.83
49 0.82
50 0.82
51 0.83
52 0.83
53 0.81
54 0.81
55 0.79