Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A165CS51

Protein Details
Accession A0A165CS51    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
222-244TPKAPKAANGKPNPNPKKRPSETHydrophilic
NLS Segment(s)
PositionSequence
225-240APKAANGKPNPNPKKR
255-260RRKKRA
Subcellular Location(s) nucl 12, mito 9.5, cyto_mito 7.5, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MESKVRALTVAKLRDALTKSSTPFPPKANKDALIVKVLDSPDALAALGLVEAKAPAAAAASPGDDNDDLLAPPAEFDWDGTANGEDKPAAAPTTAAPAKPASAAKPVPASASVKPTPAATPATATKLETPANPPDVPNPAESSVVADAEIEKRRKRAERFGVPFNELSAPSTPTPAGKPGKKGAAASPAVADDPDKLKARAERFGIATTTPSTTASSSPSATPKAPKAANGKPNPNPKKRPSETVATVDPEEEERRKKRAARFGAPTVTA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.41
3 0.37
4 0.34
5 0.33
6 0.35
7 0.4
8 0.44
9 0.44
10 0.46
11 0.48
12 0.53
13 0.55
14 0.59
15 0.58
16 0.55
17 0.53
18 0.55
19 0.51
20 0.45
21 0.39
22 0.32
23 0.3
24 0.28
25 0.23
26 0.17
27 0.15
28 0.11
29 0.11
30 0.1
31 0.06
32 0.05
33 0.05
34 0.05
35 0.04
36 0.04
37 0.03
38 0.03
39 0.04
40 0.04
41 0.03
42 0.03
43 0.04
44 0.04
45 0.05
46 0.05
47 0.07
48 0.07
49 0.07
50 0.09
51 0.08
52 0.09
53 0.08
54 0.09
55 0.07
56 0.08
57 0.09
58 0.06
59 0.07
60 0.07
61 0.07
62 0.06
63 0.06
64 0.08
65 0.08
66 0.09
67 0.09
68 0.1
69 0.1
70 0.1
71 0.1
72 0.07
73 0.07
74 0.07
75 0.07
76 0.07
77 0.06
78 0.07
79 0.07
80 0.14
81 0.14
82 0.14
83 0.14
84 0.14
85 0.14
86 0.16
87 0.17
88 0.11
89 0.16
90 0.17
91 0.17
92 0.18
93 0.18
94 0.17
95 0.18
96 0.19
97 0.15
98 0.21
99 0.2
100 0.19
101 0.19
102 0.19
103 0.18
104 0.17
105 0.17
106 0.11
107 0.12
108 0.13
109 0.15
110 0.15
111 0.15
112 0.14
113 0.15
114 0.15
115 0.14
116 0.16
117 0.16
118 0.19
119 0.19
120 0.18
121 0.17
122 0.2
123 0.2
124 0.17
125 0.17
126 0.14
127 0.14
128 0.14
129 0.14
130 0.11
131 0.1
132 0.09
133 0.07
134 0.06
135 0.1
136 0.15
137 0.17
138 0.18
139 0.2
140 0.26
141 0.33
142 0.37
143 0.43
144 0.48
145 0.55
146 0.59
147 0.64
148 0.62
149 0.57
150 0.52
151 0.43
152 0.35
153 0.24
154 0.21
155 0.15
156 0.15
157 0.13
158 0.14
159 0.13
160 0.13
161 0.14
162 0.19
163 0.24
164 0.25
165 0.29
166 0.32
167 0.37
168 0.37
169 0.38
170 0.34
171 0.35
172 0.33
173 0.29
174 0.25
175 0.2
176 0.19
177 0.17
178 0.15
179 0.09
180 0.1
181 0.14
182 0.16
183 0.16
184 0.19
185 0.25
186 0.28
187 0.32
188 0.32
189 0.31
190 0.31
191 0.32
192 0.3
193 0.25
194 0.23
195 0.19
196 0.18
197 0.15
198 0.14
199 0.14
200 0.13
201 0.14
202 0.15
203 0.16
204 0.16
205 0.18
206 0.21
207 0.23
208 0.24
209 0.28
210 0.29
211 0.35
212 0.35
213 0.38
214 0.43
215 0.49
216 0.56
217 0.59
218 0.64
219 0.65
220 0.75
221 0.79
222 0.81
223 0.81
224 0.8
225 0.82
226 0.79
227 0.79
228 0.73
229 0.73
230 0.69
231 0.65
232 0.61
233 0.53
234 0.48
235 0.4
236 0.36
237 0.3
238 0.29
239 0.29
240 0.34
241 0.35
242 0.4
243 0.47
244 0.54
245 0.59
246 0.65
247 0.69
248 0.69
249 0.73
250 0.75