Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A166ML09

Protein Details
Accession A0A166ML09   
Localization Confidence Medium
Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
46-66KSKKWYCDVCKPKHEQTRRKKBasic
NLS Segment(s)
PositionSequence
64-66RKK
Subcellular Location(s) nucl 19.5, cyto_nucl 12.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR028651  ING_fam  
IPR019786  Zinc_finger_PHD-type_CS  
IPR011011  Znf_FYVE_PHD  
IPR001965  Znf_PHD  
IPR019787  Znf_PHD-finger  
IPR013083  Znf_RING/FYVE/PHD  
Gene Ontology GO:0000785  C:chromatin  
GO:0005634  C:nucleus  
GO:0046872  F:metal ion binding  
PROSITE View protein in PROSITE  
PS01359  ZF_PHD_1  
PS50016  ZF_PHD_2  
Amino Acid Sequences MPIDPNEPVYCYCRSVSYGAMVACDDDDCPHEWFHLSCTGLDAVPKSKKWYCDVCKPKHEQTRRKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.21
3 0.21
4 0.19
5 0.2
6 0.18
7 0.17
8 0.15
9 0.13
10 0.11
11 0.1
12 0.08
13 0.05
14 0.07
15 0.08
16 0.1
17 0.1
18 0.1
19 0.1
20 0.1
21 0.12
22 0.14
23 0.12
24 0.11
25 0.12
26 0.13
27 0.12
28 0.13
29 0.12
30 0.14
31 0.18
32 0.19
33 0.24
34 0.27
35 0.3
36 0.35
37 0.44
38 0.45
39 0.52
40 0.62
41 0.64
42 0.7
43 0.75
44 0.79
45 0.8
46 0.83