Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165EFW5

Protein Details
Accession A0A165EFW5   
Localization Confidence Medium
Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
11-30SAPSSPSKSPRRRKADGSVDHydrophilic
NLS Segment(s)
PositionSequence
21-23RRR
Subcellular Location(s) nucl 15.5, cyto_nucl 9.833, mito 8.5, cyto_mito 6.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR037129  XPA_sf  
CDD cd21075  DBD_XPA-like  
Amino Acid Sequences MPKVPSAPSSSAPSSPSKSPRRRKADGSVDAYYPPGRRIKKTDIKKLYRLDDADLQGLEFKTDDRFVETGKGRSKQSRVVDTYRYKEREVELVAWRKHGGPEAFKLFLDGLKERWEKAQEKKSPLERKPFPAPVSYN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.38
3 0.44
4 0.49
5 0.57
6 0.65
7 0.73
8 0.77
9 0.79
10 0.79
11 0.8
12 0.8
13 0.78
14 0.74
15 0.65
16 0.57
17 0.51
18 0.46
19 0.38
20 0.28
21 0.24
22 0.25
23 0.25
24 0.29
25 0.35
26 0.44
27 0.51
28 0.6
29 0.67
30 0.7
31 0.73
32 0.76
33 0.75
34 0.69
35 0.64
36 0.56
37 0.48
38 0.43
39 0.37
40 0.31
41 0.25
42 0.21
43 0.17
44 0.16
45 0.13
46 0.08
47 0.07
48 0.07
49 0.08
50 0.08
51 0.09
52 0.09
53 0.09
54 0.15
55 0.16
56 0.2
57 0.23
58 0.26
59 0.26
60 0.3
61 0.32
62 0.34
63 0.37
64 0.39
65 0.39
66 0.4
67 0.46
68 0.47
69 0.5
70 0.5
71 0.48
72 0.42
73 0.4
74 0.37
75 0.34
76 0.31
77 0.3
78 0.29
79 0.35
80 0.34
81 0.34
82 0.33
83 0.3
84 0.28
85 0.3
86 0.26
87 0.21
88 0.27
89 0.3
90 0.3
91 0.29
92 0.3
93 0.24
94 0.22
95 0.23
96 0.18
97 0.15
98 0.22
99 0.24
100 0.23
101 0.28
102 0.33
103 0.35
104 0.44
105 0.53
106 0.52
107 0.58
108 0.65
109 0.71
110 0.74
111 0.75
112 0.76
113 0.73
114 0.72
115 0.75
116 0.74
117 0.66