Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A165GEG5

Protein Details
Accession A0A165GEG5    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
35-65ESELRRAARHEKKGYKRRRLRSERWRRLFADBasic
NLS Segment(s)
PositionSequence
39-61RRAARHEKKGYKRRRLRSERWRR
Subcellular Location(s) mito 11, nucl 9, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR001911  Ribosomal_S21  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01165  Ribosomal_S21  
Amino Acid Sequences PAHHLHPGRSVKVVNGNIALAYGSLRAILKRNNVESELRRAARHEKKGYKRRRLRSERWRRLFADQAR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.28
3 0.26
4 0.22
5 0.21
6 0.18
7 0.09
8 0.07
9 0.05
10 0.04
11 0.05
12 0.06
13 0.06
14 0.09
15 0.12
16 0.17
17 0.2
18 0.23
19 0.23
20 0.25
21 0.28
22 0.27
23 0.31
24 0.32
25 0.29
26 0.28
27 0.28
28 0.36
29 0.41
30 0.48
31 0.51
32 0.55
33 0.64
34 0.74
35 0.83
36 0.84
37 0.86
38 0.87
39 0.89
40 0.9
41 0.9
42 0.91
43 0.92
44 0.92
45 0.9
46 0.87
47 0.79
48 0.76