Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165EW86

Protein Details
Accession A0A165EW86   
Localization Confidence Low
Confidence Score 6
NoLS Segment(s)
PositionSequenceProtein Nature
64-86TSARTSRHYWLRNRRRLWKHASMHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13, plas 4, extr 4, nucl 3, cyto 3, cyto_nucl 3
Family & Domain DBs
Amino Acid Sequences MFHLDAQTAILAIVLTRRLFCPNTSRYHRVNQPPGSRAWARRYHRYLDWVVAAAFLGLMLQSETSARTSRHYWLRNRRRLWKHASMLCTLFVASSFRMDSL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.09
3 0.1
4 0.11
5 0.15
6 0.17
7 0.19
8 0.26
9 0.28
10 0.37
11 0.44
12 0.48
13 0.48
14 0.54
15 0.61
16 0.62
17 0.66
18 0.65
19 0.63
20 0.59
21 0.57
22 0.55
23 0.5
24 0.45
25 0.43
26 0.45
27 0.43
28 0.5
29 0.53
30 0.51
31 0.49
32 0.49
33 0.43
34 0.36
35 0.32
36 0.23
37 0.19
38 0.15
39 0.13
40 0.08
41 0.06
42 0.04
43 0.03
44 0.02
45 0.02
46 0.02
47 0.02
48 0.02
49 0.03
50 0.04
51 0.06
52 0.08
53 0.09
54 0.12
55 0.14
56 0.21
57 0.3
58 0.36
59 0.44
60 0.53
61 0.64
62 0.71
63 0.76
64 0.8
65 0.8
66 0.82
67 0.81
68 0.8
69 0.78
70 0.74
71 0.7
72 0.64
73 0.56
74 0.49
75 0.4
76 0.3
77 0.21
78 0.16
79 0.15
80 0.11
81 0.12