Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A165J570

Protein Details
Accession A0A165J570    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
70-96ERVMPRGPLYPRRRRRRRPEEAGVPAVBasic
NLS Segment(s)
PositionSequence
80-88PRRRRRRRP
Subcellular Location(s) nucl 13.5, cyto_nucl 12, cyto 9.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR011993  PH-like_dom_sf  
Amino Acid Sequences MPDTRGSPLRVYSMQRAESGLGSDYTKRPHVVRIRAEGEQFLVQLEGVEDVIRWVEGLQAAANVALDLDERVMPRGPLYPRRRRRRRPEEAGVPAVVPGGVDGDPPPERDGATIARSRLLAVTD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.39
3 0.38
4 0.34
5 0.3
6 0.27
7 0.2
8 0.14
9 0.14
10 0.16
11 0.17
12 0.2
13 0.21
14 0.22
15 0.22
16 0.29
17 0.36
18 0.42
19 0.45
20 0.49
21 0.5
22 0.5
23 0.5
24 0.42
25 0.35
26 0.27
27 0.21
28 0.14
29 0.1
30 0.08
31 0.07
32 0.07
33 0.05
34 0.04
35 0.04
36 0.04
37 0.04
38 0.04
39 0.04
40 0.03
41 0.03
42 0.04
43 0.04
44 0.04
45 0.04
46 0.04
47 0.04
48 0.04
49 0.04
50 0.03
51 0.03
52 0.02
53 0.02
54 0.03
55 0.03
56 0.04
57 0.04
58 0.06
59 0.07
60 0.07
61 0.07
62 0.13
63 0.16
64 0.25
65 0.34
66 0.44
67 0.54
68 0.66
69 0.76
70 0.82
71 0.89
72 0.9
73 0.92
74 0.91
75 0.91
76 0.89
77 0.85
78 0.77
79 0.66
80 0.55
81 0.44
82 0.34
83 0.24
84 0.14
85 0.07
86 0.06
87 0.05
88 0.05
89 0.06
90 0.1
91 0.12
92 0.14
93 0.15
94 0.14
95 0.14
96 0.14
97 0.17
98 0.17
99 0.21
100 0.23
101 0.23
102 0.25
103 0.24
104 0.25