Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A165MXC0

Protein Details
Accession A0A165MXC0    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
49-83REVHSPRRRQDRRIQRARRRRGIRRDFRARPKSREBasic
NLS Segment(s)
PositionSequence
54-82PRRRQDRRIQRARRRRGIRRDFRARPKSR
Subcellular Location(s) mito 13, nucl 6, extr 5, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR014722  Rib_L2_dom2  
IPR005756  Ribosomal_L26/L24P_euk/arc  
IPR008991  Translation_prot_SH3-like_sf  
Gene Ontology GO:0015934  C:large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF16906  Ribosomal_L26  
PROSITE View protein in PROSITE  
PS51257  PROKAR_LIPOPROTEIN  
Amino Acid Sequences MRATAGTSSPNCPSREPLATIASPTLSVASACKNATTPLPGAYGHPVQREVHSPRRRQDRRIQRARRRRGIRRDFRARPKSREAHFSAPSFVRRQIILSALFKELRQKYNARSTPIRKYDEVRIVRATLKGCEGKATRV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.4
3 0.4
4 0.37
5 0.37
6 0.35
7 0.34
8 0.3
9 0.24
10 0.2
11 0.16
12 0.13
13 0.08
14 0.08
15 0.08
16 0.1
17 0.13
18 0.13
19 0.13
20 0.13
21 0.14
22 0.15
23 0.17
24 0.15
25 0.14
26 0.15
27 0.15
28 0.16
29 0.18
30 0.21
31 0.2
32 0.21
33 0.21
34 0.2
35 0.22
36 0.27
37 0.29
38 0.35
39 0.41
40 0.45
41 0.5
42 0.61
43 0.63
44 0.63
45 0.67
46 0.68
47 0.72
48 0.77
49 0.81
50 0.8
51 0.87
52 0.9
53 0.89
54 0.87
55 0.85
56 0.85
57 0.85
58 0.85
59 0.84
60 0.84
61 0.83
62 0.84
63 0.86
64 0.81
65 0.76
66 0.75
67 0.73
68 0.65
69 0.64
70 0.59
71 0.55
72 0.53
73 0.48
74 0.42
75 0.37
76 0.38
77 0.32
78 0.28
79 0.23
80 0.19
81 0.2
82 0.18
83 0.18
84 0.19
85 0.19
86 0.19
87 0.2
88 0.2
89 0.19
90 0.27
91 0.28
92 0.29
93 0.31
94 0.33
95 0.37
96 0.48
97 0.52
98 0.5
99 0.55
100 0.58
101 0.64
102 0.67
103 0.66
104 0.58
105 0.58
106 0.6
107 0.61
108 0.59
109 0.52
110 0.47
111 0.44
112 0.44
113 0.44
114 0.37
115 0.29
116 0.32
117 0.31
118 0.28
119 0.34