Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165EY75

Protein Details
Accession A0A165EY75    Localization Confidence High Confidence Score 15.4
NoLS Segment(s)
PositionSequenceProtein Nature
34-60STPPRPEPRHFRYRSRRRPFRHPSTLDBasic
85-111AGRSDRPRACTRCKRLKVRCENVNGTRHydrophilic
NLS Segment(s)
PositionSequence
44-52FRYRSRRRP
Subcellular Location(s) nucl 15, extr 4, mito 3, cyto 3, cyto_mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS00463  ZN2_CY6_FUNGAL_1  
PS50048  ZN2_CY6_FUNGAL_2  
CDD cd00067  GAL4  
Amino Acid Sequences MHCDLTLGALGITAPRLAPTRGWILHGTTYSTTSTPPRPEPRHFRYRSRRRPFRHPSTLDIRPRPQFPSSSLFSPSLAPRSHTFAGRSDRPRACTRCKRLKVRCENVNGTRPCKRCRNANAECVTAQRKQRP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.07
3 0.09
4 0.11
5 0.11
6 0.15
7 0.21
8 0.22
9 0.25
10 0.24
11 0.25
12 0.27
13 0.27
14 0.26
15 0.2
16 0.21
17 0.19
18 0.18
19 0.17
20 0.18
21 0.23
22 0.25
23 0.31
24 0.39
25 0.44
26 0.52
27 0.6
28 0.64
29 0.7
30 0.7
31 0.73
32 0.75
33 0.8
34 0.83
35 0.84
36 0.86
37 0.81
38 0.87
39 0.87
40 0.86
41 0.85
42 0.77
43 0.71
44 0.68
45 0.7
46 0.66
47 0.61
48 0.55
49 0.48
50 0.46
51 0.44
52 0.38
53 0.31
54 0.28
55 0.28
56 0.25
57 0.24
58 0.25
59 0.22
60 0.21
61 0.22
62 0.19
63 0.19
64 0.17
65 0.18
66 0.17
67 0.22
68 0.23
69 0.23
70 0.24
71 0.25
72 0.31
73 0.37
74 0.39
75 0.42
76 0.43
77 0.46
78 0.53
79 0.54
80 0.58
81 0.6
82 0.66
83 0.69
84 0.75
85 0.81
86 0.83
87 0.88
88 0.88
89 0.87
90 0.85
91 0.82
92 0.81
93 0.77
94 0.77
95 0.7
96 0.65
97 0.65
98 0.63
99 0.61
100 0.63
101 0.61
102 0.61
103 0.67
104 0.71
105 0.7
106 0.74
107 0.72
108 0.66
109 0.62
110 0.58
111 0.52
112 0.47