Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

I2H012

Protein Details
Accession I2H012    Localization Confidence Low Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
27-46TITYKTKKDKLNKKEKETDEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12, cyto_nucl 10.5, mito 7, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR039432  SRP9_dom  
KEGG tbl:TBLA_0B08990  -  
Pfam View protein in Pfam  
PF05486  SRP9-21  
Amino Acid Sequences MSVKPIDTYIQDSVRLFQVSPSTSTITITYKTKKDKLNKKEKETDEQIKSTKTQPVNSVSFVTTNNQTSTHYSFETRKTKDVSRLLSALGPRGVTINLTKLEKKIKF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.26
3 0.21
4 0.18
5 0.21
6 0.2
7 0.22
8 0.23
9 0.21
10 0.21
11 0.22
12 0.21
13 0.18
14 0.19
15 0.22
16 0.25
17 0.28
18 0.35
19 0.4
20 0.46
21 0.54
22 0.62
23 0.68
24 0.74
25 0.77
26 0.78
27 0.82
28 0.78
29 0.75
30 0.73
31 0.7
32 0.63
33 0.57
34 0.5
35 0.42
36 0.4
37 0.35
38 0.33
39 0.27
40 0.25
41 0.25
42 0.29
43 0.3
44 0.29
45 0.28
46 0.22
47 0.21
48 0.19
49 0.18
50 0.15
51 0.15
52 0.15
53 0.14
54 0.15
55 0.18
56 0.2
57 0.2
58 0.19
59 0.2
60 0.22
61 0.3
62 0.37
63 0.36
64 0.38
65 0.4
66 0.44
67 0.49
68 0.53
69 0.5
70 0.45
71 0.44
72 0.4
73 0.39
74 0.35
75 0.3
76 0.24
77 0.2
78 0.15
79 0.16
80 0.15
81 0.14
82 0.15
83 0.16
84 0.19
85 0.23
86 0.25
87 0.28