Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165DIL9

Protein Details
Accession A0A165DIL9   
Localization Confidence Medium
Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
12-34FPAPHAPVNRRRIKRPRQLLALAHydrophilic
54-77YAHPKKAGAPRKPRAPPKKKLDYEBasic
NLS Segment(s)
PositionSequence
21-26RRRIKR
57-73PKKAGAPRKPRAPPKKK
Subcellular Location(s) mito 18, mito_nucl 12.333, cyto_mito 11.333, nucl 5.5
Family & Domain DBs
Amino Acid Sequences MSALIARRVPLFPAPHAPVNRRRIKRPRQLLALALLPPRPILCTMPKHRYSNYYAHPKKAGAPRKPRAPPKKKLDYEDDAEIIGVLPDDARLDLPTRDCGRKPRAQPKKLDDAEIIGTLPDDAPTRSNPMKGTNVFKFDFKSEAPAAGNRNTTTTTRKRQRDAEEDTDGHDGDDEKESRVTVAREVAGTKRRKLRV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.41
3 0.45
4 0.5
5 0.53
6 0.6
7 0.66
8 0.64
9 0.7
10 0.74
11 0.8
12 0.84
13 0.85
14 0.83
15 0.81
16 0.79
17 0.71
18 0.64
19 0.57
20 0.48
21 0.4
22 0.32
23 0.24
24 0.21
25 0.18
26 0.16
27 0.14
28 0.14
29 0.19
30 0.28
31 0.36
32 0.45
33 0.51
34 0.54
35 0.54
36 0.56
37 0.55
38 0.54
39 0.54
40 0.56
41 0.53
42 0.53
43 0.53
44 0.48
45 0.5
46 0.51
47 0.52
48 0.5
49 0.58
50 0.61
51 0.69
52 0.76
53 0.79
54 0.81
55 0.81
56 0.82
57 0.81
58 0.84
59 0.79
60 0.76
61 0.73
62 0.67
63 0.61
64 0.53
65 0.44
66 0.33
67 0.28
68 0.23
69 0.15
70 0.1
71 0.06
72 0.03
73 0.02
74 0.02
75 0.03
76 0.03
77 0.03
78 0.04
79 0.05
80 0.07
81 0.08
82 0.12
83 0.15
84 0.18
85 0.19
86 0.26
87 0.31
88 0.37
89 0.44
90 0.5
91 0.58
92 0.61
93 0.68
94 0.67
95 0.7
96 0.65
97 0.59
98 0.48
99 0.4
100 0.35
101 0.28
102 0.22
103 0.11
104 0.1
105 0.08
106 0.07
107 0.06
108 0.05
109 0.05
110 0.07
111 0.08
112 0.14
113 0.15
114 0.17
115 0.18
116 0.22
117 0.27
118 0.29
119 0.35
120 0.33
121 0.37
122 0.36
123 0.35
124 0.33
125 0.28
126 0.28
127 0.22
128 0.24
129 0.19
130 0.21
131 0.21
132 0.22
133 0.24
134 0.24
135 0.27
136 0.21
137 0.23
138 0.23
139 0.24
140 0.29
141 0.35
142 0.42
143 0.49
144 0.56
145 0.61
146 0.67
147 0.73
148 0.73
149 0.73
150 0.69
151 0.66
152 0.59
153 0.56
154 0.5
155 0.41
156 0.32
157 0.24
158 0.18
159 0.13
160 0.19
161 0.17
162 0.17
163 0.18
164 0.18
165 0.18
166 0.21
167 0.2
168 0.17
169 0.2
170 0.2
171 0.21
172 0.23
173 0.29
174 0.34
175 0.38
176 0.43