Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A166AZV6

Protein Details
Accession A0A166AZV6   
Localization Confidence Medium
Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
187-208FEQRIAAWWKRRDRDRARDSASHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13, mito 8, cyto 5
Family & Domain DBs
Amino Acid Sequences MRAALASGEPVSLTIDSFTPYGLGSFRNPVVPFYTIPDDERASRAVVHGSACMSRNRATRARPAPPMLIHQFVGQTLWLYWPCTPANLHELAPENDAVSWTRMVTHLEQMHAVVLRPGECFFMPSMSSYITLSLGYDGTNIAAHLKYSLLPQQRASASTTTITTTVSGTDDQHPPNPDSERDPRPSFEQRIAAWWKRRDRDRARDSASGSGTRSTTTSL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.08
3 0.1
4 0.1
5 0.1
6 0.08
7 0.08
8 0.09
9 0.09
10 0.1
11 0.11
12 0.15
13 0.16
14 0.21
15 0.22
16 0.22
17 0.25
18 0.25
19 0.24
20 0.24
21 0.28
22 0.24
23 0.26
24 0.27
25 0.26
26 0.25
27 0.26
28 0.22
29 0.18
30 0.17
31 0.17
32 0.15
33 0.14
34 0.14
35 0.13
36 0.13
37 0.14
38 0.16
39 0.17
40 0.18
41 0.21
42 0.25
43 0.3
44 0.34
45 0.35
46 0.43
47 0.49
48 0.52
49 0.53
50 0.51
51 0.5
52 0.46
53 0.49
54 0.42
55 0.37
56 0.31
57 0.26
58 0.24
59 0.19
60 0.18
61 0.12
62 0.09
63 0.07
64 0.09
65 0.08
66 0.09
67 0.1
68 0.13
69 0.13
70 0.13
71 0.14
72 0.13
73 0.16
74 0.16
75 0.16
76 0.15
77 0.18
78 0.18
79 0.18
80 0.16
81 0.13
82 0.11
83 0.11
84 0.1
85 0.08
86 0.07
87 0.06
88 0.07
89 0.07
90 0.09
91 0.1
92 0.14
93 0.14
94 0.14
95 0.14
96 0.14
97 0.14
98 0.12
99 0.11
100 0.07
101 0.06
102 0.06
103 0.07
104 0.07
105 0.08
106 0.07
107 0.08
108 0.08
109 0.08
110 0.08
111 0.08
112 0.09
113 0.08
114 0.09
115 0.08
116 0.09
117 0.08
118 0.08
119 0.07
120 0.06
121 0.06
122 0.05
123 0.05
124 0.05
125 0.05
126 0.05
127 0.05
128 0.06
129 0.05
130 0.05
131 0.06
132 0.06
133 0.06
134 0.08
135 0.14
136 0.18
137 0.2
138 0.21
139 0.26
140 0.26
141 0.27
142 0.28
143 0.23
144 0.19
145 0.19
146 0.18
147 0.15
148 0.14
149 0.13
150 0.11
151 0.1
152 0.09
153 0.1
154 0.1
155 0.11
156 0.15
157 0.19
158 0.21
159 0.25
160 0.28
161 0.28
162 0.31
163 0.32
164 0.3
165 0.32
166 0.38
167 0.4
168 0.44
169 0.46
170 0.45
171 0.49
172 0.55
173 0.53
174 0.5
175 0.49
176 0.42
177 0.47
178 0.53
179 0.54
180 0.54
181 0.58
182 0.62
183 0.65
184 0.73
185 0.76
186 0.77
187 0.81
188 0.81
189 0.83
190 0.8
191 0.77
192 0.71
193 0.67
194 0.61
195 0.53
196 0.45
197 0.39
198 0.33
199 0.28