Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165PTB6

Protein Details
Accession A0A165PTB6   
Localization Confidence Low
Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MYTPRPFKNPNYTKNVNRRMRNYKAVHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12, mito 9, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR029525  INO80C/Ies6  
IPR013272  Vps72/YL1_C  
Gene Ontology GO:0031011  C:Ino80 complex  
GO:0006338  P:chromatin remodeling  
Pfam View protein in Pfam  
PF08265  YL1_C  
Amino Acid Sequences MYTPRPFKNPNYTKNVNRRMRNYKAVLAAERERERVLRETQRQQIADGIEGVEDVPPTYLSIEAPPSLLPQPHYCDITGLEGPYTDPATGLRYHDKSVYEFIRGMARTEKFYLSARGVNPIVK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.83
3 0.81
4 0.8
5 0.8
6 0.8
7 0.8
8 0.79
9 0.73
10 0.67
11 0.64
12 0.59
13 0.52
14 0.48
15 0.44
16 0.43
17 0.41
18 0.37
19 0.32
20 0.29
21 0.3
22 0.29
23 0.33
24 0.34
25 0.4
26 0.46
27 0.51
28 0.56
29 0.53
30 0.49
31 0.45
32 0.36
33 0.3
34 0.22
35 0.15
36 0.09
37 0.09
38 0.08
39 0.05
40 0.04
41 0.04
42 0.04
43 0.04
44 0.04
45 0.04
46 0.05
47 0.04
48 0.05
49 0.06
50 0.06
51 0.06
52 0.06
53 0.08
54 0.08
55 0.09
56 0.1
57 0.12
58 0.16
59 0.18
60 0.19
61 0.17
62 0.17
63 0.17
64 0.19
65 0.17
66 0.13
67 0.11
68 0.1
69 0.1
70 0.1
71 0.1
72 0.07
73 0.06
74 0.07
75 0.09
76 0.1
77 0.13
78 0.19
79 0.2
80 0.22
81 0.25
82 0.26
83 0.26
84 0.31
85 0.3
86 0.25
87 0.24
88 0.23
89 0.27
90 0.26
91 0.26
92 0.27
93 0.27
94 0.28
95 0.3
96 0.3
97 0.26
98 0.28
99 0.31
100 0.28
101 0.31
102 0.29
103 0.33