Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165IC55

Protein Details
Accession A0A165IC55    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
16-45PYPRSRSTTPIRRWRSKPRALRRLNSKRTPHydrophilic
NLS Segment(s)
PositionSequence
26-43IRRWRSKPRALRRLNSKR
Subcellular Location(s) nucl 14, mito 12, cyto_nucl 8.5
Family & Domain DBs
Amino Acid Sequences MPHRMHASPFVRSDPPYPRSRSTTPIRRWRSKPRALRRLNSKRTPSLRIGATCPATSPTGAATSATSRLSSSAQNAYVNHALYQA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.42
3 0.44
4 0.47
5 0.47
6 0.51
7 0.52
8 0.54
9 0.55
10 0.6
11 0.62
12 0.68
13 0.72
14 0.73
15 0.77
16 0.81
17 0.82
18 0.81
19 0.82
20 0.82
21 0.84
22 0.82
23 0.82
24 0.82
25 0.82
26 0.82
27 0.79
28 0.73
29 0.69
30 0.67
31 0.64
32 0.56
33 0.5
34 0.44
35 0.37
36 0.35
37 0.32
38 0.3
39 0.25
40 0.22
41 0.2
42 0.17
43 0.16
44 0.13
45 0.1
46 0.1
47 0.1
48 0.1
49 0.09
50 0.1
51 0.13
52 0.13
53 0.12
54 0.11
55 0.13
56 0.14
57 0.15
58 0.17
59 0.19
60 0.21
61 0.24
62 0.24
63 0.29
64 0.31
65 0.3