Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165ZEZ2

Protein Details
Accession A0A165ZEZ2    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
15-35CTLPGKPTKPTKPTKGPRAVVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 21, cyto 3.5, cyto_nucl 3.5
Family & Domain DBs
Amino Acid Sequences MGFSTRCSRRSSAQCTLPGKPTKPTKPTKGPRAVVDWVANLFKRDMAEFVGWHGTNSNTAALWQQAGYLANPRTSGWPWGGSGGTSGADHELGDGACRE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.64
3 0.65
4 0.64
5 0.61
6 0.55
7 0.54
8 0.56
9 0.57
10 0.61
11 0.66
12 0.67
13 0.71
14 0.79
15 0.81
16 0.81
17 0.76
18 0.7
19 0.67
20 0.6
21 0.52
22 0.43
23 0.34
24 0.25
25 0.23
26 0.21
27 0.16
28 0.13
29 0.11
30 0.1
31 0.1
32 0.09
33 0.09
34 0.1
35 0.09
36 0.1
37 0.12
38 0.11
39 0.11
40 0.11
41 0.09
42 0.09
43 0.1
44 0.09
45 0.06
46 0.07
47 0.07
48 0.07
49 0.07
50 0.06
51 0.06
52 0.06
53 0.07
54 0.07
55 0.13
56 0.14
57 0.14
58 0.15
59 0.16
60 0.18
61 0.19
62 0.21
63 0.18
64 0.18
65 0.18
66 0.19
67 0.19
68 0.15
69 0.15
70 0.13
71 0.12
72 0.1
73 0.1
74 0.09
75 0.09
76 0.09
77 0.08
78 0.09
79 0.08