Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A165I381

Protein Details
Accession A0A165I381    Localization Confidence Low Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MSRLPRLSRVRARTRDRPGRGARBasic
NLS Segment(s)
PositionSequence
10-22VRARTRDRPGRGA
Subcellular Location(s) mito 24, nucl 1, cyto 1, cyto_nucl 1, pero 1, cyto_pero 1
Family & Domain DBs
Amino Acid Sequences MSRLPRLSRVRARTRDRPGRGARHQAVARVRTRVSSLSLVSHGLSRYVGFSLSLFPSSLASRYVSHVLARVIPGFGFSVSFPHDSHRPACCFAWFASIVLIDSHVLTPLAPSVPVSHRLYTSRS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.85
3 0.81
4 0.81
5 0.8
6 0.8
7 0.79
8 0.79
9 0.71
10 0.69
11 0.64
12 0.61
13 0.59
14 0.55
15 0.5
16 0.44
17 0.41
18 0.34
19 0.35
20 0.3
21 0.27
22 0.23
23 0.21
24 0.19
25 0.19
26 0.19
27 0.17
28 0.17
29 0.13
30 0.11
31 0.1
32 0.09
33 0.09
34 0.08
35 0.08
36 0.06
37 0.06
38 0.08
39 0.08
40 0.09
41 0.08
42 0.08
43 0.09
44 0.09
45 0.09
46 0.08
47 0.09
48 0.09
49 0.11
50 0.13
51 0.12
52 0.12
53 0.13
54 0.12
55 0.11
56 0.11
57 0.1
58 0.08
59 0.08
60 0.08
61 0.07
62 0.06
63 0.06
64 0.06
65 0.07
66 0.09
67 0.11
68 0.1
69 0.13
70 0.16
71 0.18
72 0.22
73 0.26
74 0.26
75 0.28
76 0.28
77 0.26
78 0.26
79 0.24
80 0.25
81 0.2
82 0.18
83 0.15
84 0.15
85 0.14
86 0.12
87 0.12
88 0.08
89 0.08
90 0.08
91 0.07
92 0.07
93 0.06
94 0.07
95 0.08
96 0.08
97 0.08
98 0.08
99 0.12
100 0.15
101 0.23
102 0.26
103 0.26
104 0.29