Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A166ND43

Protein Details
Accession A0A166ND43    Localization Confidence Low Confidence Score 7.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-34MKTSPKCRRFPLQRRSRLRLRCARFRRLPRPLVHHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 8mito 8mito_nucl 8, plas 7
Family & Domain DBs
Amino Acid Sequences MKTSPKCRRFPLQRRSRLRLRCARFRRLPRPLVHLSMCLIGVIAPTWIHDTRGTHARSRWASSVQALLPCVVRAQSSQHPTALGYILQICCTSSGRRALRRLT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.88
3 0.87
4 0.84
5 0.84
6 0.83
7 0.8
8 0.8
9 0.78
10 0.81
11 0.8
12 0.82
13 0.82
14 0.81
15 0.8
16 0.73
17 0.73
18 0.67
19 0.62
20 0.53
21 0.44
22 0.36
23 0.29
24 0.25
25 0.17
26 0.13
27 0.08
28 0.06
29 0.05
30 0.05
31 0.03
32 0.04
33 0.07
34 0.08
35 0.09
36 0.1
37 0.11
38 0.13
39 0.21
40 0.22
41 0.21
42 0.23
43 0.29
44 0.29
45 0.32
46 0.31
47 0.26
48 0.25
49 0.24
50 0.25
51 0.2
52 0.19
53 0.16
54 0.15
55 0.13
56 0.12
57 0.11
58 0.09
59 0.08
60 0.08
61 0.13
62 0.19
63 0.24
64 0.25
65 0.26
66 0.26
67 0.25
68 0.26
69 0.22
70 0.15
71 0.11
72 0.14
73 0.13
74 0.14
75 0.13
76 0.12
77 0.13
78 0.15
79 0.17
80 0.18
81 0.27
82 0.34
83 0.42