Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A165IC00

Protein Details
Accession A0A165IC00    Localization Confidence Low Confidence Score 6.5
NoLS Segment(s)
PositionSequenceProtein Nature
47-67GKMKHLPFRRGRQRATKPLQLHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 16, mito 7, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR025724  GAG-pre-integrase_dom  
Pfam View protein in Pfam  
PF13976  gag_pre-integrs  
Amino Acid Sequences AMDINVLHRRLGHQSFDALRRAVAAGHIKGVSKLTGTQKFCDACAIGKMKHLPFRRGRQRATKPLQLVHVDLCGPVK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.34
3 0.37
4 0.37
5 0.3
6 0.26
7 0.23
8 0.22
9 0.17
10 0.16
11 0.17
12 0.14
13 0.16
14 0.17
15 0.16
16 0.16
17 0.17
18 0.13
19 0.09
20 0.13
21 0.18
22 0.24
23 0.26
24 0.26
25 0.29
26 0.29
27 0.29
28 0.26
29 0.2
30 0.13
31 0.16
32 0.18
33 0.15
34 0.18
35 0.22
36 0.24
37 0.31
38 0.34
39 0.38
40 0.43
41 0.54
42 0.62
43 0.65
44 0.69
45 0.72
46 0.78
47 0.81
48 0.8
49 0.78
50 0.71
51 0.67
52 0.66
53 0.58
54 0.5
55 0.41
56 0.36
57 0.28