Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165Q1K1

Protein Details
Accession A0A165Q1K1   
Localization Confidence Low
Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
66-102GSLSGQRRRHRLHRRSQRPLKRCRHLRHELWSRPPRSBasic
NLS Segment(s)
PositionSequence
71-101QRRRHRLHRRSQRPLKRCRHLRHELWSRPPR
Subcellular Location(s) mito 24, nucl 1, cyto 1, plas 1, cyto_nucl 1
Family & Domain DBs
Amino Acid Sequences MRHLVRAVQVARTVKMKTRYSSPARTRTAQVVRGRPAPSGRFGVVKPVPPARPAHVFVTRSLHRTGSLSGQRRRHRLHRRSQRPLKRCRHLRHELWSRPPRSSSRGTGSARLA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.4
3 0.42
4 0.39
5 0.44
6 0.51
7 0.54
8 0.63
9 0.64
10 0.65
11 0.65
12 0.65
13 0.61
14 0.61
15 0.59
16 0.56
17 0.55
18 0.52
19 0.51
20 0.53
21 0.51
22 0.44
23 0.43
24 0.37
25 0.33
26 0.3
27 0.27
28 0.23
29 0.22
30 0.28
31 0.26
32 0.27
33 0.26
34 0.28
35 0.28
36 0.27
37 0.29
38 0.24
39 0.27
40 0.26
41 0.28
42 0.28
43 0.28
44 0.27
45 0.32
46 0.3
47 0.28
48 0.27
49 0.23
50 0.18
51 0.19
52 0.19
53 0.2
54 0.26
55 0.31
56 0.37
57 0.45
58 0.5
59 0.57
60 0.61
61 0.65
62 0.68
63 0.7
64 0.75
65 0.77
66 0.82
67 0.86
68 0.91
69 0.91
70 0.89
71 0.91
72 0.9
73 0.89
74 0.89
75 0.87
76 0.86
77 0.85
78 0.82
79 0.82
80 0.83
81 0.8
82 0.8
83 0.81
84 0.74
85 0.68
86 0.66
87 0.61
88 0.57
89 0.56
90 0.52
91 0.5
92 0.57
93 0.56