Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165J0M5

Protein Details
Accession A0A165J0M5    Localization Confidence High Confidence Score 17.4
NoLS Segment(s)
PositionSequenceProtein Nature
290-312DFDVPGKRSRKGKKQVKMTPEEEBasic
NLS Segment(s)
PositionSequence
143-152SKKRKRAGPK
201-201K
295-328GKRSRKGKKQVKMTPEEEAAWKPRVYKWKFDRKR
Subcellular Location(s) nucl 20.5, cyto_nucl 13, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007144  SSU_processome_Utp11  
Gene Ontology GO:0005730  C:nucleolus  
GO:0032040  C:small-subunit processome  
GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF03998  Utp11  
Amino Acid Sequences ERGQLAHRTRLGILEKHKDYVLRARDYHSKQDRIHRLKEKAATRNQDEFYFGMVNQRTKDGVHVQERGNAVMPVDIVKVLKTQDGNYIRTVRAAGAKKIDALKTELGAITDLPAGDEWEDEDLSSQEKRALQEAGLLPGASGSKKRKRAGPKHLVFVESEEQARSLATPAAPSAPVAQAEQADEAMDAADDLGWAIETKKKRKRDVVPTSSSTSQSAGGEDDDEDTSKPKRHRSQVIKELAARLTRDRSLKFAERELEMQKLLMGKGAAKKLRGLEKDGAGKRDEDDEDDFDVPGKRSRKGKKQVKMTPEEEAAWKPRVYKWKFDRKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.48
3 0.47
4 0.48
5 0.43
6 0.42
7 0.45
8 0.45
9 0.42
10 0.41
11 0.44
12 0.53
13 0.56
14 0.63
15 0.62
16 0.62
17 0.61
18 0.7
19 0.75
20 0.73
21 0.78
22 0.77
23 0.74
24 0.73
25 0.76
26 0.74
27 0.72
28 0.74
29 0.72
30 0.69
31 0.71
32 0.65
33 0.58
34 0.52
35 0.43
36 0.37
37 0.3
38 0.23
39 0.23
40 0.24
41 0.27
42 0.25
43 0.26
44 0.24
45 0.23
46 0.27
47 0.26
48 0.31
49 0.34
50 0.38
51 0.37
52 0.41
53 0.42
54 0.38
55 0.33
56 0.25
57 0.19
58 0.15
59 0.14
60 0.1
61 0.09
62 0.09
63 0.08
64 0.08
65 0.1
66 0.1
67 0.13
68 0.13
69 0.13
70 0.22
71 0.26
72 0.28
73 0.3
74 0.33
75 0.3
76 0.3
77 0.29
78 0.21
79 0.25
80 0.26
81 0.25
82 0.25
83 0.25
84 0.28
85 0.31
86 0.3
87 0.24
88 0.24
89 0.22
90 0.19
91 0.19
92 0.17
93 0.13
94 0.12
95 0.11
96 0.08
97 0.08
98 0.07
99 0.06
100 0.06
101 0.06
102 0.06
103 0.06
104 0.05
105 0.06
106 0.06
107 0.05
108 0.06
109 0.06
110 0.07
111 0.08
112 0.08
113 0.09
114 0.11
115 0.12
116 0.14
117 0.14
118 0.13
119 0.18
120 0.18
121 0.17
122 0.15
123 0.14
124 0.12
125 0.12
126 0.12
127 0.07
128 0.11
129 0.17
130 0.24
131 0.32
132 0.35
133 0.41
134 0.52
135 0.62
136 0.68
137 0.72
138 0.68
139 0.67
140 0.66
141 0.6
142 0.49
143 0.42
144 0.33
145 0.23
146 0.19
147 0.13
148 0.11
149 0.11
150 0.1
151 0.07
152 0.06
153 0.06
154 0.05
155 0.06
156 0.06
157 0.07
158 0.07
159 0.07
160 0.07
161 0.07
162 0.08
163 0.08
164 0.08
165 0.07
166 0.08
167 0.08
168 0.06
169 0.06
170 0.05
171 0.05
172 0.04
173 0.03
174 0.03
175 0.03
176 0.02
177 0.02
178 0.02
179 0.02
180 0.02
181 0.03
182 0.04
183 0.08
184 0.14
185 0.23
186 0.31
187 0.39
188 0.46
189 0.55
190 0.64
191 0.7
192 0.77
193 0.76
194 0.75
195 0.72
196 0.7
197 0.62
198 0.54
199 0.43
200 0.33
201 0.26
202 0.19
203 0.16
204 0.12
205 0.1
206 0.1
207 0.09
208 0.1
209 0.08
210 0.09
211 0.08
212 0.1
213 0.12
214 0.17
215 0.21
216 0.29
217 0.37
218 0.45
219 0.56
220 0.64
221 0.72
222 0.76
223 0.8
224 0.74
225 0.68
226 0.62
227 0.55
228 0.47
229 0.38
230 0.32
231 0.28
232 0.29
233 0.32
234 0.29
235 0.31
236 0.35
237 0.41
238 0.4
239 0.41
240 0.39
241 0.37
242 0.4
243 0.38
244 0.34
245 0.26
246 0.24
247 0.2
248 0.19
249 0.17
250 0.15
251 0.13
252 0.14
253 0.19
254 0.27
255 0.28
256 0.28
257 0.31
258 0.35
259 0.44
260 0.43
261 0.43
262 0.41
263 0.44
264 0.53
265 0.53
266 0.5
267 0.43
268 0.41
269 0.36
270 0.36
271 0.31
272 0.25
273 0.25
274 0.25
275 0.27
276 0.26
277 0.25
278 0.22
279 0.24
280 0.22
281 0.25
282 0.26
283 0.28
284 0.37
285 0.47
286 0.56
287 0.64
288 0.73
289 0.76
290 0.83
291 0.87
292 0.87
293 0.86
294 0.78
295 0.74
296 0.67
297 0.6
298 0.52
299 0.48
300 0.43
301 0.38
302 0.36
303 0.32
304 0.36
305 0.44
306 0.45
307 0.51
308 0.56