Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165E9V7

Protein Details
Accession A0A165E9V7   
Localization Confidence Medium
Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
199-224GKPATQARNARRRRKRLGQRQPGDTSHydrophilic
NLS Segment(s)
PositionSequence
200-216KPATQARNARRRRKRLG
Subcellular Location(s) nucl 14.5, cyto_nucl 10, mito 8, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MRIRLNAAPPLPSYKAWYVFPGALRDDTTASVRDLKRALCDSIFPDCPPEELAFFVEGYELLDNTPLEVVQADDILNVKQTVTRTTITKRKTRDEDVPDQSAKKRLKVSATAASSSRPRSPSTSSSSSSSASSSSSSASSSSTSSDSDSDSDSSSTSSSLHVARKPVPKPNSKALHPLSGYGHAAEKPKFEHLVPPGQGKPATQARNARRRRKRLGQRQPGDTSLGSSEGPSAPPEGPTHSSVAAALPVQVTAMMLRNKGKRKSFLTSGPDATNTPSRIVFPTSDSPATAQKLPRLVPPSERDDLPANVLVTSVDVEADLWGKRNRRRSARFSEPAPYVEEEEAEVVFVKGSAKAVAPAPALDIKWPMLARILSSPAVGAMLAWQTLDINPATLSPEMMIRTGNVVAVNADAGTVQLAVTRAEVAFGAALTDEEEEEIEELEVSLADILDKDDWRLLS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.38
3 0.36
4 0.37
5 0.35
6 0.36
7 0.38
8 0.36
9 0.32
10 0.3
11 0.3
12 0.28
13 0.26
14 0.24
15 0.23
16 0.2
17 0.2
18 0.27
19 0.26
20 0.29
21 0.31
22 0.3
23 0.34
24 0.36
25 0.38
26 0.3
27 0.32
28 0.31
29 0.35
30 0.35
31 0.29
32 0.3
33 0.27
34 0.27
35 0.26
36 0.24
37 0.18
38 0.17
39 0.18
40 0.15
41 0.14
42 0.13
43 0.11
44 0.09
45 0.1
46 0.09
47 0.07
48 0.07
49 0.09
50 0.08
51 0.09
52 0.09
53 0.07
54 0.07
55 0.07
56 0.08
57 0.06
58 0.07
59 0.06
60 0.07
61 0.08
62 0.08
63 0.09
64 0.09
65 0.08
66 0.1
67 0.12
68 0.14
69 0.17
70 0.19
71 0.22
72 0.3
73 0.38
74 0.42
75 0.48
76 0.51
77 0.57
78 0.62
79 0.64
80 0.66
81 0.67
82 0.7
83 0.69
84 0.69
85 0.62
86 0.58
87 0.54
88 0.53
89 0.47
90 0.43
91 0.42
92 0.4
93 0.43
94 0.46
95 0.49
96 0.49
97 0.49
98 0.46
99 0.41
100 0.39
101 0.38
102 0.35
103 0.34
104 0.28
105 0.28
106 0.3
107 0.35
108 0.38
109 0.41
110 0.43
111 0.41
112 0.42
113 0.41
114 0.38
115 0.33
116 0.28
117 0.2
118 0.16
119 0.15
120 0.12
121 0.11
122 0.1
123 0.1
124 0.1
125 0.1
126 0.1
127 0.1
128 0.11
129 0.11
130 0.11
131 0.12
132 0.12
133 0.12
134 0.12
135 0.13
136 0.13
137 0.12
138 0.12
139 0.11
140 0.11
141 0.1
142 0.09
143 0.08
144 0.08
145 0.09
146 0.13
147 0.16
148 0.18
149 0.21
150 0.28
151 0.35
152 0.38
153 0.45
154 0.49
155 0.53
156 0.56
157 0.62
158 0.62
159 0.56
160 0.61
161 0.55
162 0.54
163 0.46
164 0.43
165 0.35
166 0.31
167 0.29
168 0.21
169 0.2
170 0.15
171 0.19
172 0.17
173 0.17
174 0.16
175 0.18
176 0.19
177 0.18
178 0.21
179 0.2
180 0.27
181 0.27
182 0.3
183 0.28
184 0.29
185 0.29
186 0.23
187 0.25
188 0.25
189 0.26
190 0.27
191 0.35
192 0.41
193 0.51
194 0.6
195 0.65
196 0.68
197 0.74
198 0.79
199 0.81
200 0.84
201 0.85
202 0.87
203 0.87
204 0.83
205 0.81
206 0.75
207 0.65
208 0.56
209 0.45
210 0.34
211 0.24
212 0.19
213 0.12
214 0.1
215 0.1
216 0.07
217 0.08
218 0.07
219 0.08
220 0.08
221 0.09
222 0.09
223 0.11
224 0.13
225 0.14
226 0.15
227 0.14
228 0.13
229 0.12
230 0.12
231 0.1
232 0.07
233 0.06
234 0.05
235 0.04
236 0.04
237 0.04
238 0.04
239 0.04
240 0.08
241 0.09
242 0.1
243 0.15
244 0.22
245 0.29
246 0.35
247 0.39
248 0.41
249 0.45
250 0.49
251 0.49
252 0.51
253 0.5
254 0.48
255 0.46
256 0.41
257 0.37
258 0.31
259 0.29
260 0.26
261 0.21
262 0.18
263 0.16
264 0.16
265 0.17
266 0.18
267 0.16
268 0.16
269 0.19
270 0.21
271 0.21
272 0.2
273 0.2
274 0.22
275 0.23
276 0.23
277 0.21
278 0.2
279 0.24
280 0.24
281 0.28
282 0.29
283 0.28
284 0.31
285 0.33
286 0.37
287 0.35
288 0.35
289 0.32
290 0.31
291 0.3
292 0.26
293 0.24
294 0.18
295 0.15
296 0.15
297 0.13
298 0.1
299 0.1
300 0.07
301 0.05
302 0.04
303 0.04
304 0.05
305 0.07
306 0.07
307 0.1
308 0.14
309 0.21
310 0.26
311 0.36
312 0.44
313 0.53
314 0.61
315 0.67
316 0.72
317 0.76
318 0.76
319 0.69
320 0.67
321 0.59
322 0.52
323 0.46
324 0.38
325 0.3
326 0.25
327 0.22
328 0.16
329 0.14
330 0.12
331 0.09
332 0.08
333 0.06
334 0.06
335 0.06
336 0.06
337 0.06
338 0.07
339 0.08
340 0.08
341 0.1
342 0.11
343 0.14
344 0.14
345 0.13
346 0.15
347 0.16
348 0.16
349 0.15
350 0.15
351 0.13
352 0.16
353 0.16
354 0.14
355 0.16
356 0.16
357 0.16
358 0.18
359 0.2
360 0.17
361 0.17
362 0.17
363 0.13
364 0.13
365 0.11
366 0.08
367 0.06
368 0.06
369 0.06
370 0.06
371 0.06
372 0.07
373 0.07
374 0.09
375 0.08
376 0.08
377 0.08
378 0.08
379 0.11
380 0.1
381 0.11
382 0.09
383 0.12
384 0.12
385 0.12
386 0.12
387 0.1
388 0.13
389 0.13
390 0.13
391 0.11
392 0.1
393 0.1
394 0.1
395 0.1
396 0.07
397 0.07
398 0.05
399 0.05
400 0.05
401 0.05
402 0.04
403 0.06
404 0.07
405 0.07
406 0.08
407 0.09
408 0.09
409 0.09
410 0.09
411 0.08
412 0.08
413 0.07
414 0.07
415 0.06
416 0.06
417 0.06
418 0.07
419 0.06
420 0.06
421 0.07
422 0.07
423 0.07
424 0.08
425 0.07
426 0.07
427 0.07
428 0.06
429 0.06
430 0.06
431 0.06
432 0.05
433 0.05
434 0.05
435 0.07
436 0.1
437 0.11
438 0.12