Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I2H5M3

Protein Details
Accession I2H5M3    Localization Confidence Low Confidence Score 7.3
NoLS Segment(s)
PositionSequenceProtein Nature
83-111MEAIAQRKKVLRKNNRDRIKQNNFLKQLKHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 20, nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR013870  Ribosomal_L37_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
KEGG tbl:TBLA_0F01320  -  
Pfam View protein in Pfam  
PF08561  Ribosomal_L37  
Amino Acid Sequences MFARRSLSTFANRLLQQELMPAAKAAAKKTPQQAIKSSCPAGTELRLNVYKDGKDPVALEDEKYPPWLWSILTPSNNKNPSPMEAIAQRKKVLRKNNRDRIKQNNFLKQLK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.31
3 0.24
4 0.23
5 0.23
6 0.16
7 0.16
8 0.14
9 0.12
10 0.13
11 0.15
12 0.14
13 0.19
14 0.21
15 0.26
16 0.32
17 0.39
18 0.42
19 0.44
20 0.5
21 0.49
22 0.52
23 0.51
24 0.46
25 0.39
26 0.35
27 0.33
28 0.27
29 0.23
30 0.2
31 0.16
32 0.18
33 0.2
34 0.2
35 0.2
36 0.21
37 0.19
38 0.18
39 0.19
40 0.15
41 0.14
42 0.14
43 0.12
44 0.15
45 0.14
46 0.14
47 0.14
48 0.16
49 0.15
50 0.16
51 0.16
52 0.11
53 0.12
54 0.12
55 0.1
56 0.11
57 0.16
58 0.2
59 0.24
60 0.27
61 0.29
62 0.37
63 0.4
64 0.38
65 0.35
66 0.32
67 0.31
68 0.34
69 0.31
70 0.26
71 0.29
72 0.39
73 0.41
74 0.43
75 0.42
76 0.42
77 0.49
78 0.53
79 0.57
80 0.59
81 0.65
82 0.73
83 0.81
84 0.86
85 0.88
86 0.88
87 0.88
88 0.87
89 0.86
90 0.84
91 0.83