Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A165F9V3

Protein Details
Accession A0A165F9V3    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
5-25SSQSPSTRTCRNKNGNAARRSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17, cyto_nucl 11, mito 7
Family & Domain DBs
Amino Acid Sequences MASVSSQSPSTRTCRNKNGNAARRSRSLHSDTARNALDSTRRWRQTKWSTSSSNSSNSMSGRSWRSARDQQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.62
3 0.67
4 0.75
5 0.81
6 0.81
7 0.8
8 0.78
9 0.72
10 0.67
11 0.63
12 0.55
13 0.5
14 0.45
15 0.44
16 0.4
17 0.41
18 0.37
19 0.38
20 0.36
21 0.3
22 0.26
23 0.2
24 0.21
25 0.19
26 0.24
27 0.28
28 0.33
29 0.35
30 0.36
31 0.46
32 0.52
33 0.59
34 0.59
35 0.58
36 0.56
37 0.58
38 0.63
39 0.56
40 0.49
41 0.43
42 0.37
43 0.33
44 0.29
45 0.29
46 0.24
47 0.27
48 0.27
49 0.3
50 0.31
51 0.32