Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A165NF48

Protein Details
Accession A0A165NF48    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
29-53RNEKAIPRRRQRNEMKYNKRSRSRVBasic
NLS Segment(s)
PositionSequence
37-38RR
Subcellular Location(s) plas 11, extr 8, mito 6
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MVSTTLSCAWTSWATAGAIRTACVCALFRNEKAIPRRRQRNEMKYNKRSRSRVLTLSVLTLLTFSLDIAFDPACAPGCS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.14
3 0.15
4 0.14
5 0.13
6 0.13
7 0.13
8 0.11
9 0.11
10 0.1
11 0.1
12 0.09
13 0.15
14 0.18
15 0.18
16 0.23
17 0.25
18 0.29
19 0.37
20 0.45
21 0.48
22 0.54
23 0.64
24 0.63
25 0.72
26 0.76
27 0.78
28 0.8
29 0.82
30 0.83
31 0.82
32 0.87
33 0.86
34 0.85
35 0.78
36 0.73
37 0.71
38 0.66
39 0.61
40 0.56
41 0.51
42 0.43
43 0.4
44 0.34
45 0.25
46 0.19
47 0.14
48 0.1
49 0.07
50 0.06
51 0.05
52 0.05
53 0.05
54 0.05
55 0.07
56 0.07
57 0.07
58 0.07
59 0.08