Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A165LIY8

Protein Details
Accession A0A165LIY8    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MIYPRRRRRREDVRANGIGRBasic
NLS Segment(s)
PositionSequence
5-10RRRRRR
Subcellular Location(s) mito 22, nucl 3
Family & Domain DBs
Amino Acid Sequences MIYPRRRRRREDVRANGIGRPRSSLCTVTSSRGYRRLAMRCKYRNTLQVRAARQVEHGVLGLDAYAHVEFNF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.78
3 0.71
4 0.65
5 0.58
6 0.47
7 0.41
8 0.33
9 0.29
10 0.3
11 0.28
12 0.24
13 0.26
14 0.27
15 0.26
16 0.3
17 0.29
18 0.29
19 0.34
20 0.33
21 0.31
22 0.36
23 0.41
24 0.43
25 0.47
26 0.54
27 0.54
28 0.58
29 0.6
30 0.58
31 0.58
32 0.57
33 0.57
34 0.55
35 0.56
36 0.54
37 0.55
38 0.53
39 0.45
40 0.4
41 0.36
42 0.29
43 0.22
44 0.19
45 0.13
46 0.11
47 0.1
48 0.09
49 0.06
50 0.05
51 0.06
52 0.06