Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165DEA5

Protein Details
Accession A0A165DEA5   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
15-36APSHPSDKPRLRERIRQFPPSWHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 27
Family & Domain DBs
InterPro View protein in InterPro  
IPR004695  SLAC1/Mae1/Ssu1/TehA  
IPR038665  Voltage-dep_anion_channel_sf  
Gene Ontology GO:0016020  C:membrane  
GO:0055085  P:transmembrane transport  
Pfam View protein in Pfam  
PF03595  SLAC1  
CDD cd09318  TDT_SSU1  
Amino Acid Sequences MASSTRTAENGSELAPSHPSDKPRLRERIRQFPPSWHAVIMGTGVVSILFHAFPYGQQHGVLRGLSWAFTLLNGCLFVVFSGMTVARYILFPYVWRLMLLHPVQSLFLGCIPMGFATLVNQGVNLVNDYQLGGNKAFVYTLWAAWGLDAAVSVLVCFGMVHIKITRHKHSLENMTAAWLLPVVAPIVASTTGQLVAGILTPHSHTLALLTSTVSLVLVLIGLSLSLMIFATYYPRLVIHGLPATGLIISVFLPLGPCAQGGYSLLLAADILPPLLPALDSPFISSDAGTAALRVLLLAAAFMLWVLGTMWLVLACLAVWDVARRNKISFALPFWGLIFPNGVYTLLTLQLGKAFGGAAFFVDFGAAWAALTLVVWIAVAIPTVRFAHSGTIFYAPCLDRTPLNVPRAPEDTA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.18
3 0.19
4 0.2
5 0.22
6 0.26
7 0.34
8 0.42
9 0.49
10 0.56
11 0.65
12 0.68
13 0.75
14 0.8
15 0.81
16 0.8
17 0.81
18 0.74
19 0.73
20 0.72
21 0.68
22 0.6
23 0.49
24 0.43
25 0.34
26 0.31
27 0.23
28 0.17
29 0.1
30 0.08
31 0.07
32 0.06
33 0.05
34 0.05
35 0.05
36 0.05
37 0.05
38 0.06
39 0.06
40 0.08
41 0.15
42 0.17
43 0.16
44 0.18
45 0.19
46 0.21
47 0.23
48 0.21
49 0.15
50 0.16
51 0.15
52 0.14
53 0.13
54 0.12
55 0.09
56 0.1
57 0.11
58 0.08
59 0.09
60 0.09
61 0.09
62 0.08
63 0.08
64 0.07
65 0.06
66 0.06
67 0.05
68 0.06
69 0.07
70 0.07
71 0.07
72 0.07
73 0.07
74 0.08
75 0.08
76 0.08
77 0.08
78 0.08
79 0.13
80 0.15
81 0.15
82 0.15
83 0.15
84 0.15
85 0.23
86 0.23
87 0.2
88 0.18
89 0.18
90 0.18
91 0.17
92 0.17
93 0.09
94 0.09
95 0.08
96 0.07
97 0.07
98 0.07
99 0.07
100 0.07
101 0.06
102 0.05
103 0.06
104 0.08
105 0.09
106 0.08
107 0.08
108 0.08
109 0.09
110 0.09
111 0.09
112 0.07
113 0.07
114 0.07
115 0.08
116 0.08
117 0.08
118 0.1
119 0.09
120 0.09
121 0.09
122 0.09
123 0.09
124 0.08
125 0.11
126 0.1
127 0.1
128 0.1
129 0.1
130 0.1
131 0.1
132 0.1
133 0.05
134 0.04
135 0.04
136 0.03
137 0.03
138 0.03
139 0.03
140 0.03
141 0.03
142 0.03
143 0.02
144 0.03
145 0.05
146 0.06
147 0.07
148 0.09
149 0.13
150 0.19
151 0.25
152 0.3
153 0.31
154 0.33
155 0.36
156 0.4
157 0.45
158 0.41
159 0.37
160 0.32
161 0.3
162 0.28
163 0.23
164 0.17
165 0.09
166 0.07
167 0.05
168 0.05
169 0.04
170 0.03
171 0.03
172 0.03
173 0.04
174 0.04
175 0.04
176 0.04
177 0.04
178 0.05
179 0.05
180 0.05
181 0.04
182 0.04
183 0.04
184 0.04
185 0.04
186 0.04
187 0.05
188 0.05
189 0.06
190 0.05
191 0.05
192 0.05
193 0.06
194 0.06
195 0.06
196 0.06
197 0.05
198 0.05
199 0.05
200 0.04
201 0.04
202 0.03
203 0.03
204 0.03
205 0.02
206 0.02
207 0.02
208 0.02
209 0.02
210 0.02
211 0.02
212 0.02
213 0.02
214 0.02
215 0.02
216 0.02
217 0.05
218 0.05
219 0.06
220 0.06
221 0.06
222 0.07
223 0.08
224 0.09
225 0.1
226 0.11
227 0.11
228 0.1
229 0.1
230 0.09
231 0.08
232 0.08
233 0.04
234 0.03
235 0.04
236 0.04
237 0.04
238 0.03
239 0.04
240 0.04
241 0.05
242 0.05
243 0.05
244 0.05
245 0.05
246 0.05
247 0.06
248 0.07
249 0.06
250 0.06
251 0.06
252 0.05
253 0.05
254 0.05
255 0.05
256 0.04
257 0.04
258 0.03
259 0.04
260 0.04
261 0.04
262 0.03
263 0.03
264 0.07
265 0.09
266 0.09
267 0.1
268 0.11
269 0.12
270 0.12
271 0.12
272 0.08
273 0.07
274 0.09
275 0.08
276 0.07
277 0.06
278 0.06
279 0.06
280 0.05
281 0.05
282 0.03
283 0.03
284 0.03
285 0.03
286 0.03
287 0.03
288 0.02
289 0.02
290 0.02
291 0.02
292 0.03
293 0.03
294 0.03
295 0.03
296 0.04
297 0.04
298 0.04
299 0.04
300 0.03
301 0.03
302 0.03
303 0.03
304 0.04
305 0.04
306 0.06
307 0.12
308 0.17
309 0.21
310 0.23
311 0.24
312 0.27
313 0.29
314 0.32
315 0.29
316 0.28
317 0.29
318 0.27
319 0.26
320 0.24
321 0.24
322 0.19
323 0.17
324 0.14
325 0.1
326 0.11
327 0.11
328 0.1
329 0.08
330 0.09
331 0.1
332 0.09
333 0.1
334 0.09
335 0.08
336 0.1
337 0.11
338 0.1
339 0.09
340 0.08
341 0.08
342 0.08
343 0.08
344 0.06
345 0.06
346 0.06
347 0.06
348 0.06
349 0.05
350 0.05
351 0.07
352 0.06
353 0.05
354 0.05
355 0.05
356 0.05
357 0.05
358 0.05
359 0.03
360 0.03
361 0.03
362 0.03
363 0.04
364 0.04
365 0.05
366 0.05
367 0.05
368 0.08
369 0.1
370 0.11
371 0.11
372 0.12
373 0.19
374 0.2
375 0.22
376 0.21
377 0.25
378 0.24
379 0.24
380 0.3
381 0.23
382 0.23
383 0.25
384 0.25
385 0.21
386 0.27
387 0.35
388 0.36
389 0.42
390 0.44
391 0.42
392 0.46