Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I2H019

Protein Details
Accession I2H019    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
249-274YGPTWRRDPNWTRKFRQRKIIIDKIEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 26.5, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR022210  TF_GCR1-like  
Gene Ontology GO:0110165  C:cellular anatomical entity  
KEGG tbl:TBLA_0B09060  -  
Pfam View protein in Pfam  
PF12550  GCR1_C  
Amino Acid Sequences MNEGSTASHSTPIDSPENNTNNKSSNGNNTPLTTTTLGKSSVLENISGASRKTGSNTIEKNRTDEILKLLASIQDQNSNLKVGIEHLQRHCEEEYLHDFIKIKKRHDTLSKWNKSIKNMTYILQEIQSITNEGTNVVPTLRNTARSISLQNVHIDEFSLFSHNVINHDSSRRDETERLKDIDRTEIILNKRVKLEDEEDFDINNPNYQRDRDFKLAKINISVCTVYEVAKEYYQGFAGRPSLMYMEYKYGPTWRRDPNWTRKFRQRKIIIDKIEDVKKNPTKYGLRPNITREQAIRAVASVESYERCTLPKLVQYFKEKKINLPIIFYRDILELYQK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.3
3 0.35
4 0.41
5 0.42
6 0.43
7 0.41
8 0.4
9 0.41
10 0.41
11 0.35
12 0.39
13 0.41
14 0.43
15 0.42
16 0.41
17 0.41
18 0.39
19 0.39
20 0.31
21 0.27
22 0.24
23 0.24
24 0.23
25 0.21
26 0.2
27 0.17
28 0.2
29 0.19
30 0.17
31 0.15
32 0.15
33 0.18
34 0.18
35 0.17
36 0.14
37 0.15
38 0.15
39 0.18
40 0.23
41 0.24
42 0.31
43 0.38
44 0.44
45 0.51
46 0.51
47 0.52
48 0.48
49 0.47
50 0.4
51 0.34
52 0.3
53 0.25
54 0.24
55 0.2
56 0.19
57 0.19
58 0.18
59 0.19
60 0.17
61 0.18
62 0.19
63 0.21
64 0.21
65 0.2
66 0.19
67 0.16
68 0.15
69 0.13
70 0.19
71 0.21
72 0.26
73 0.27
74 0.32
75 0.32
76 0.35
77 0.33
78 0.27
79 0.23
80 0.22
81 0.25
82 0.24
83 0.24
84 0.22
85 0.23
86 0.27
87 0.36
88 0.36
89 0.35
90 0.39
91 0.42
92 0.47
93 0.54
94 0.57
95 0.58
96 0.65
97 0.68
98 0.64
99 0.68
100 0.65
101 0.62
102 0.62
103 0.53
104 0.49
105 0.44
106 0.41
107 0.37
108 0.35
109 0.3
110 0.23
111 0.2
112 0.14
113 0.13
114 0.12
115 0.1
116 0.09
117 0.09
118 0.08
119 0.08
120 0.07
121 0.07
122 0.07
123 0.07
124 0.07
125 0.07
126 0.13
127 0.13
128 0.16
129 0.16
130 0.18
131 0.19
132 0.2
133 0.21
134 0.19
135 0.21
136 0.2
137 0.2
138 0.19
139 0.17
140 0.15
141 0.14
142 0.11
143 0.09
144 0.08
145 0.08
146 0.07
147 0.07
148 0.09
149 0.09
150 0.1
151 0.11
152 0.12
153 0.12
154 0.14
155 0.15
156 0.15
157 0.18
158 0.19
159 0.2
160 0.23
161 0.28
162 0.33
163 0.36
164 0.37
165 0.35
166 0.36
167 0.34
168 0.34
169 0.28
170 0.22
171 0.19
172 0.22
173 0.22
174 0.27
175 0.27
176 0.25
177 0.26
178 0.24
179 0.24
180 0.22
181 0.24
182 0.2
183 0.23
184 0.24
185 0.23
186 0.22
187 0.22
188 0.22
189 0.18
190 0.18
191 0.14
192 0.14
193 0.16
194 0.17
195 0.2
196 0.21
197 0.27
198 0.32
199 0.35
200 0.34
201 0.42
202 0.43
203 0.41
204 0.41
205 0.36
206 0.3
207 0.3
208 0.28
209 0.18
210 0.18
211 0.17
212 0.13
213 0.12
214 0.14
215 0.13
216 0.13
217 0.14
218 0.12
219 0.12
220 0.13
221 0.13
222 0.11
223 0.11
224 0.13
225 0.12
226 0.12
227 0.12
228 0.12
229 0.12
230 0.13
231 0.12
232 0.14
233 0.15
234 0.16
235 0.15
236 0.21
237 0.24
238 0.28
239 0.34
240 0.38
241 0.42
242 0.51
243 0.6
244 0.65
245 0.71
246 0.75
247 0.75
248 0.78
249 0.84
250 0.81
251 0.83
252 0.8
253 0.8
254 0.81
255 0.83
256 0.78
257 0.72
258 0.69
259 0.66
260 0.64
261 0.56
262 0.49
263 0.5
264 0.51
265 0.49
266 0.46
267 0.48
268 0.47
269 0.53
270 0.62
271 0.61
272 0.61
273 0.63
274 0.67
275 0.68
276 0.65
277 0.6
278 0.5
279 0.47
280 0.44
281 0.41
282 0.34
283 0.25
284 0.23
285 0.2
286 0.19
287 0.14
288 0.12
289 0.12
290 0.15
291 0.16
292 0.15
293 0.17
294 0.19
295 0.21
296 0.24
297 0.29
298 0.32
299 0.37
300 0.43
301 0.52
302 0.57
303 0.62
304 0.67
305 0.62
306 0.63
307 0.67
308 0.69
309 0.61
310 0.6
311 0.57
312 0.54
313 0.55
314 0.49
315 0.4
316 0.32
317 0.31